DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Axn and rgs-2

DIOPT Version :9

Sequence 1:NP_733336.1 Gene:Axn / 43565 FlyBaseID:FBgn0026597 Length:745 Species:Drosophila melanogaster
Sequence 2:NP_001379248.1 Gene:rgs-2 / 181414 WormBaseID:WBGene00004345 Length:181 Species:Caenorhabditis elegans


Alignment Length:163 Identity:45/163 - (27%)
Similarity:79/163 - (48%) Gaps:21/163 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 NECSGPRPPVPGEESRVKKMTEGVADTSKNSSPSY---LNWARTLNHLLEDRDGVELFKKYVEEE 75
            |.....:|.|.|..|..||..|      .:..|:|   ..|:::..:|::.|.|.:.|.::::.|
 Worm    18 NSSPSGKPYVSGSVSVEKKNQE------NDGPPTYEIVFGWSQSFENLMKHRAGQKYFAEFLKGE 76

  Fly    76 APAYND-HLNFYFACEGLKQQTDPEKIKQIIGAIYR----FLRKSQLSISDDLRAQIKAIKTNPE 135
               |:| ::.|:.|||.||::.:.|||::....||.    .|...::|:...:|   :.:.||..
 Worm    77 ---YSDENILFWQACEELKREKNAEKIEEKARIIYEDFISILSPKEVSLDSRVR---EIVNTNMG 135

  Fly   136 IPLSPHIFDPMQRHVEVTIRDNIYPTFLCSEMY 168
            .| |...||..|..:...::.:.||.||.|.:|
 Worm   136 RP-SASTFDEAQNQIYTLMQRDSYPRFLASNIY 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AxnNP_733336.1 RGS 55..170 CDD:295367 34/119 (29%)
Axin_b-cat_bind 494..543 CDD:285982
DIX 665..739 CDD:279160
rgs-2NP_001379248.1 RGS 52..169 CDD:413378 35/123 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.