DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Axn and si:ch211-117l17.6

DIOPT Version :10

Sequence 1:NP_733336.1 Gene:Axn / 43565 FlyBaseID:FBgn0026597 Length:745 Species:Drosophila melanogaster
Sequence 2:XP_001923588.6 Gene:si:ch211-117l17.6 / 100151245 ZFINID:ZDB-GENE-110914-213 Length:193 Species:Danio rerio


Alignment Length:118 Identity:32/118 - (27%)
Similarity:55/118 - (46%) Gaps:10/118 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 LNHLLEDRDGVELFKKYVEEEAPAYNDHLNFYFACEGLKQQTDPEKIKQIIGAIYR-FLR---KS 115
            |..|||:.|.:..|:.:::.|..|.|  :.|:.||...||.....|:......||: ||.   :.
Zfish    71 LADLLENTDYLAAFQSFLQSEFSAEN--IEFWLACREYKQIRSTGKLSSKAAEIYKTFLHSTAQK 133

  Fly   116 QLSISDDLRAQIKAIKTNPEIPLSPHIFDPMQRHVEVTIRDNIYPTFLCSEMY 168
            :::|....|.:||.....|::    ..||..::.|...:.::..|.||.||.:
Zfish   134 EVNIDHCTREEIKRSLAKPDL----GCFDKAEKLVYRLMEEDSCPRFLKSEAF 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AxnNP_733336.1 RGS 55..170 CDD:470619 32/118 (27%)
Axin_b-cat_bind 495..530 CDD:462616
DIX 665..741 CDD:459936
si:ch211-117l17.6XP_001923588.6 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.