DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Axn and cep112

DIOPT Version :9

Sequence 1:NP_733336.1 Gene:Axn / 43565 FlyBaseID:FBgn0026597 Length:745 Species:Drosophila melanogaster
Sequence 2:XP_031750093.1 Gene:cep112 / 100135020 XenbaseID:XB-GENE-6047288 Length:943 Species:Xenopus tropicalis


Alignment Length:335 Identity:61/335 - (18%)
Similarity:121/335 - (36%) Gaps:69/335 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   345 VYNPSTTNTSYVPNSRVDSERASVSSGGRTDSDTMS--------ISSCSMDGRPY-----IQRRH 396
            :.||.......:..|.:....:....||..|...:|        :.:.:|:.:.:     :|::|
 Frog   202 IENPRYLREKPITLSPIGPRMSQAKVGGSWDEQALSRLQEKEGDMKTKAMEAKFHEEKLRLQQKH 266

  Fly   397 SSTESKAIRQSAMANKETNTFQVIPRTQRLHSNEHRPLKEEELVSLLIPKLEEVKRKRDLEERAR 461
            .:...|.:.:.   |.||...:.:.||::..|        ||.:..|..|::.:.|:..|....:
 Frog   267 DADVQKILDRK---NSETEELKELYRTKQAES--------EETIRKLEKKVQALLRESQLIRETK 320

  Fly   462 ERNPGAALLTNERSSAS---------DRAFAEAIREKFALDE---DNDQDILDQHVSRVWKDQTP 514
            |..........|:|..|         ..|.||..:|||.|.:   :|.|.:||...:|:.|.::.
 Frog   321 ENQISELKKMCEQSGESLNSEWERKLHSAVAEMEQEKFELQKKHTENIQQLLDDTNARLLKMESE 385

  Fly   515 H--RSPGTMSPCPPI---------------PSRRRTATHDSGM----------VSDGAMSLSGHS 552
            :  :|..|......:               ..|:|.|...:.:          :.|.....|...
 Frog   386 YVAQSKATAQTVKELELRVQQLTVEAESSNAQRQRLAQEKAELDKVHQSVSRDLQDAKARCSLLE 450

  Fly   553 MKHSKSMPDHSSCSRKLTNKWPSMNTDSGISMFSADTVTKYKDASSRSGSSTASKLEEAKRRLED 617
            .:..:...||....::|..|     :||.|:..:.....:...|::..| ....|:.:.|::|::
 Frog   451 QERERHRQDHERQIQQLKGK-----SDSDINYITQQNALQAVKAANAIG-DLEEKVSQLKQQLQE 509

  Fly   618 EPRRSRRYAQ 627
            ...|..:..|
 Frog   510 AEHRMHQRLQ 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AxnNP_733336.1 RGS 55..170 CDD:295367
Axin_b-cat_bind 494..543 CDD:285982 11/78 (14%)
DIX 665..739 CDD:279160
cep112XP_031750093.1 DUF4485 11..94 CDD:405527
Smc 247..>895 CDD:224117 54/290 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1481971at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.