DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nlp and npm2a

DIOPT Version :9

Sequence 1:NP_001263094.1 Gene:Nlp / 43560 FlyBaseID:FBgn0016685 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001186842.1 Gene:npm2a / 797865 ZFINID:ZDB-GENE-060810-57 Length:156 Species:Danio rerio


Alignment Length:124 Identity:36/124 - (29%)
Similarity:64/124 - (51%) Gaps:7/124 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YGVTLTAESDSVTWDVDEDYARGQKLVIKQILLGAEAKENEFNVVEV-NTPKDSVQIPIAVLKAG 70
            :|..|:....:..:..:.|....| ..||.|.|..:|.: |.::|.| :....|..:|||.|:..
Zfish    37 WGCVLSGSKTTAVFKAENDLLENQ-FFIKTICLSEDAGD-EMHIVAVCDGVGASKPLPIATLRHC 99

  Fly    71 ETRAVNPDVEFYESKVTFKLIKGSGPVYIHGHNIK-DDVEVVDMEEDDEEDDVAEDEED 128
            ......|.:|.. ..|||||..|.|||::...:|. :.:|:::.||::::|:  |::||
Zfish   100 MPMISFPGLELI-PPVTFKLCSGKGPVFVSAQHITLNPIEMIEEEEEEKQDE--EEDED 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NlpNP_001263094.1 Nucleoplasmin 6..104 CDD:397268 28/97 (29%)
npm2aNP_001186842.1 Nucleoplasmin 37..132 CDD:308605 28/97 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594266
Domainoid 1 1.000 46 1.000 Domainoid score I12094
eggNOG 1 0.900 - - E1_2C49J
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 60 1.000 Inparanoid score I5397
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000973
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_113323
Panther 1 1.100 - - O PTHR22747
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.790

Return to query results.
Submit another query.