Sequence 1: | NP_001263094.1 | Gene: | Nlp / 43560 | FlyBaseID: | FBgn0016685 | Length: | 152 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005173145.2 | Gene: | npm1b / 553507 | ZFINID: | ZDB-GENE-080723-7 | Length: | 316 | Species: | Danio rerio |
Alignment Length: | 205 | Identity: | 52/205 - (25%) |
---|---|---|---|
Similarity: | 88/205 - (42%) | Gaps: | 66/205 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 YGVTLTAESDSVTWDVDEDYARGQKLVIKQILLGAEAKENEFNVVE---VNTPKDSVQIPIAVLK 68
Fly 69 AGETRAVNPDVEFYESKVT----FKLIKGSGPVYIHGHNI------------------------- 104
Fly 105 ---------------KDDVEVVDMEEDDEEDDVAEDEEDEHPKKRAKIEN-------------AA 141
Fly 142 DGKNAKNNKK 151 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Nlp | NP_001263094.1 | Nucleoplasmin | 6..104 | CDD:397268 | 37/103 (36%) |
npm1b | XP_005173145.2 | Nucleoplasmin | 32..131 | CDD:308605 | 37/103 (36%) |
NPM1-C | 265..313 | CDD:318505 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170594268 | |
Domainoid | 1 | 1.000 | 46 | 1.000 | Domainoid score | I12094 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 60 | 1.000 | Inparanoid score | I5397 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1485080at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000973 | |
OrthoInspector | 1 | 1.000 | - | - | oto41272 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR22747 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
8 | 8.000 |