DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nlp and npm1b

DIOPT Version :9

Sequence 1:NP_001263094.1 Gene:Nlp / 43560 FlyBaseID:FBgn0016685 Length:152 Species:Drosophila melanogaster
Sequence 2:XP_005173145.2 Gene:npm1b / 553507 ZFINID:ZDB-GENE-080723-7 Length:316 Species:Danio rerio


Alignment Length:205 Identity:52/205 - (25%)
Similarity:88/205 - (42%) Gaps:66/205 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YGVTLTAESDSVTWDVDEDYARGQKLVIKQILLGAEAKENEFNVVE---VNTPKDSVQIPIAVLK 68
            :|.:|.|:......|:|:|.|..| |.:|.:.||||| |::|:.||   :.....:.:|.:||||
Zfish    33 FGCSLKADKKEHKVDLDDDEAEHQ-LSLKSVCLGAEA-EDKFHTVEMEGLTYDGKTTKITLAVLK 95

  Fly    69 AGETRAVNPDVEFYESKVT----FKLIKGSGPVYIHGHNI------------------------- 104
            .    :|.|.:.....:||    |:|..|.|||||.|.:.                         
Zfish    96 P----SVLPSLSLGGFEVTPPVSFRLQSGGGPVYISGQHFVSVKESDDEDEEEEENNTSPVKRPS 156

  Fly   105 ---------------KDDVEVVDMEEDDEEDDVAEDEEDEHPKKRAKIEN-------------AA 141
                           .|:.|..|.::||::||..::|||:..:::..:::             :|
Zfish   157 NMTLAKVPQKKLKMDSDEDEDSDDDDDDDDDDDDDEEEDDDKQEKPAVKSPVKSTQKTPEKKKSA 221

  Fly   142 DGKNAKNNKK 151
            |.:|...:||
Zfish   222 DKQNGSPDKK 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NlpNP_001263094.1 Nucleoplasmin 6..104 CDD:397268 37/103 (36%)
npm1bXP_005173145.2 Nucleoplasmin 32..131 CDD:308605 37/103 (36%)
NPM1-C 265..313 CDD:318505
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594268
Domainoid 1 1.000 46 1.000 Domainoid score I12094
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 60 1.000 Inparanoid score I5397
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1485080at2759
OrthoFinder 1 1.000 - - FOG0000973
OrthoInspector 1 1.000 - - oto41272
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22747
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
88.000

Return to query results.
Submit another query.