DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nlp and npm2

DIOPT Version :9

Sequence 1:NP_001263094.1 Gene:Nlp / 43560 FlyBaseID:FBgn0016685 Length:152 Species:Drosophila melanogaster
Sequence 2:XP_012814520.1 Gene:npm2 / 549692 XenbaseID:XB-GENE-999546 Length:200 Species:Xenopus tropicalis


Alignment Length:153 Identity:50/153 - (32%)
Similarity:86/153 - (56%) Gaps:9/153 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YGVTLTAESDSVTWDVDEDYARGQ-KLVIKQILLGAEAKENEFNVVEVNTPKDSVQ--IPIAVLK 68
            :|..|:.::.:..:.:.||..:.: :|.::.:.||.:||: ||:|||:.|.::..:  :|||.||
 Frog    19 WGCELSEQNKTFEFKISEDEDKCEHQLALRTVCLGDKAKD-EFHVVEIVTKEEGAEKPVPIATLK 82

  Fly    69 AG-ETRAVNPDVEFYESKVTFKLIKGSGPVYIHGHNI--KDDVEVVDMEEDDEEDDVAEDEEDEH 130
            .. ...|....:|. ...|||:|..|||||||.|.::  :||....:.|::.|.::..|:||:|.
 Frog    83 PSILPMATMVGIEL-TPPVTFRLKAGSGPVYISGQHVAMEDDYSWAEEEDEGEGEEGEEEEEEED 146

  Fly   131 PKKRAK-IENAADGKNAKNNKKK 152
            |:...| ::..|..|.|...|||
 Frog   147 PESPPKAVKRPAATKKAGQAKKK 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NlpNP_001263094.1 Nucleoplasmin 6..104 CDD:397268 34/100 (34%)
npm2XP_012814520.1 Nucleoplasmin 18..118 CDD:367319 34/100 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10665
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I5031
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1485080at2759
OrthoFinder 1 1.000 - - FOG0000973
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22747
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.160

Return to query results.
Submit another query.