DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nlp and npm3

DIOPT Version :9

Sequence 1:NP_001263094.1 Gene:Nlp / 43560 FlyBaseID:FBgn0016685 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001016456.1 Gene:npm3 / 549210 XenbaseID:XB-GENE-954429 Length:177 Species:Xenopus tropicalis


Alignment Length:159 Identity:57/159 - (35%)
Similarity:91/159 - (57%) Gaps:12/159 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AEESF-YGVTLTAESDSVTWDVDEDYARGQKLVIKQILLGAEAKENEFNVVEV---NTPKDSVQI 62
            |.||: :|..|::::...|:.|||:......:.::.|.|||.||: |.|||||   |.....|.:
 Frog    16 AVESYLFGCELSSKTKQYTFQVDEEDDASHCVCLQTISLGAGAKD-EHNVVEVTAHNYQDKEVTV 79

  Fly    63 PIAVLKAGETRAVNPDVEFYESK--VTFKLIKGSGPVYIHGHN---IKDDVEVVDMEEDDEEDDV 122
            |:|.||......||  ||::|.:  |||:|..|||||:|.|.:   |.||:::...:|||:::|:
 Frog    80 PLANLKLSCQPMVN--VEYFEIEPPVTFRLTSGSGPVFISGRHYIVINDDIDLSGSDEDDDDEDI 142

  Fly   123 AEDEEDEHPKKRAKIENAADGKNAKNNKK 151
            .:|::|:......:.|.....|.||.:.|
 Frog   143 DDDDDDDDDDDEEEEEVVTPIKPAKKSLK 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NlpNP_001263094.1 Nucleoplasmin 6..104 CDD:397268 40/106 (38%)
npm3NP_001016456.1 Nucleoplasmin 18..>129 CDD:281111 45/113 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10665
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I5031
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1485080at2759
OrthoFinder 1 1.000 - - FOG0000973
OrthoInspector 1 1.000 - - oto103303
Panther 1 1.100 - - LDO PTHR22747
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R11310
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.100

Return to query results.
Submit another query.