DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nlp and npm3

DIOPT Version :9

Sequence 1:NP_001263094.1 Gene:Nlp / 43560 FlyBaseID:FBgn0016685 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001013502.1 Gene:npm3 / 541357 ZFINID:ZDB-GENE-050320-50 Length:163 Species:Danio rerio


Alignment Length:155 Identity:51/155 - (32%)
Similarity:73/155 - (47%) Gaps:31/155 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EESFYGVTLTAESDSVTWDVDEDYARGQKLVIKQILLGAEAKENEFNVVEV---NTPKDSVQIPI 64
            |...:...|::.....|:..|||......|.::.|.||..||| |.|||||   |.....:.:|:
Zfish    20 ESYVFSCELSSGVPFYTFQADEDEDVEHFLELRTICLGDGAKE-ENNVVEVTAMNHQGKKISVPV 83

  Fly    65 A--------VLKAGETRAVNPDVEFYESKVTFKLIKGSGPVYIHGHNI----KDDVEVVDMEEDD 117
            |        ::..||...:.|        ||.:|..|||||.|.|.::    .::.|:.|  |||
Zfish    84 ANLNITCLPMVSLGEFELMAP--------VTLRLKSGSGPVTISGLHLVATENEESEISD--EDD 138

  Fly   118 EEDDVAEDEEDEHP-----KKRAKI 137
            ||||..:|.|:|.|     ||:.|:
Zfish   139 EEDDDEDDSEEELPSVKPAKKKQKV 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NlpNP_001263094.1 Nucleoplasmin 6..104 CDD:397268 34/108 (31%)
npm3NP_001013502.1 Nucleoplasmin 20..>127 CDD:281111 35/115 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594270
Domainoid 1 1.000 46 1.000 Domainoid score I12094
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 60 1.000 Inparanoid score I5397
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1485080at2759
OrthoFinder 1 1.000 - - FOG0000973
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.