DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nlp and Npm3

DIOPT Version :9

Sequence 1:NP_001263094.1 Gene:Nlp / 43560 FlyBaseID:FBgn0016685 Length:152 Species:Drosophila melanogaster
Sequence 2:XP_577868.2 Gene:Npm3 / 502389 RGDID:1565542 Length:173 Species:Rattus norvegicus


Alignment Length:126 Identity:38/126 - (30%)
Similarity:64/126 - (50%) Gaps:11/126 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FYGVTLTAESDSVTWDVDEDYARGQKLVIKQILLGAEAKENEFNVVEV---NTPKDSVQIPIAVL 67
            |:|..|::.:.|.|:.|:|:......|.:..:.| .|..::|.|||||   :.....:.:|:|.|
  Rat    38 FFGCELSSHTRSFTFKVEEEDDTEHVLALNMLCL-TEGAKDECNVVEVVARDHDNQEIAVPVANL 101

  Fly    68 KAGETRAVNPDVEFYESKVTFKLIKGSGPVYIHGHNIKDDVEVVDMEED--DEEDDVAEDE 126
            :......::.|....:..|||:|..|||||.|.|.:     ::|.:..|  :|..|.:|||
  Rat   102 RLSCQPMLSVDDFQLQPPVTFRLKSGSGPVRITGRH-----QIVCINNDLSEESPDESEDE 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NlpNP_001263094.1 Nucleoplasmin 6..104 CDD:397268 31/100 (31%)
Npm3XP_577868.2 Nucleoplasmin 38..139 CDD:397268 31/106 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352343
Domainoid 1 1.000 45 1.000 Domainoid score I11857
eggNOG 1 0.900 - - E1_2C49J
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I5285
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1485080at2759
OrthoFinder 1 1.000 - - FOG0000973
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR22747
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.