DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nlp and Npm2

DIOPT Version :9

Sequence 1:NP_001263094.1 Gene:Nlp / 43560 FlyBaseID:FBgn0016685 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_851990.2 Gene:Npm2 / 328440 MGIID:1890811 Length:207 Species:Mus musculus


Alignment Length:170 Identity:58/170 - (34%)
Similarity:76/170 - (44%) Gaps:32/170 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AEESFYGVTLTAESDSVTWDVDEDYARGQ-------KLVIKQILLGAEAKENEFNVVEVNTPKD- 58
            |:...:|..|..|..:.|:       |||       ||::..|.||.:||| |.|.|||.:.:. 
Mouse    14 AKNMLWGSELNQEKQTCTF-------RGQGEKKDSCKLLLSTICLGEKAKE-EVNRVEVLSQEGR 70

  Fly    59 SVQIPIAVLKAGETRAVNPDVEFYESKVTFKLIKGSGPVYIHGHNIKDDVEVVDME-EDDEEDDV 122
            ...|.||.|||.....|..........|||:|..|||||::.|   .:..|..|:. |||||::.
Mouse    71 KPPITIATLKASVLPMVTVSGIELSPPVTFRLRTGSGPVFLSG---LECYETSDLTWEDDEEEEE 132

  Fly   123 AEDEEDEH----------PKKRAKIENAADGKNAKNNKKK 152
            .|:||||.          |.|:.|  ..|..|.....|||
Mouse   133 EEEEEDEDEDADISLEEIPVKQVK--RVAPQKQMSIAKKK 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NlpNP_001263094.1 Nucleoplasmin 6..104 CDD:397268 37/105 (35%)
Npm2NP_851990.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 1/5 (20%)
Nucleoplasmin 18..116 CDD:367319 37/108 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..207 19/52 (37%)
Acidic tract A2. /evidence=ECO:0000250 129..152 6/22 (27%)
Bipartite nuclear localization signal. /evidence=ECO:0000250 165..180 3/6 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848744
Domainoid 1 1.000 44 1.000 Domainoid score I12219
eggNOG 1 0.900 - - E1_2C49J
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I5420
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1485080at2759
OrthoFinder 1 1.000 - - FOG0000973
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22747
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.