DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nlp and npm1a

DIOPT Version :9

Sequence 1:NP_001263094.1 Gene:Nlp / 43560 FlyBaseID:FBgn0016685 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_955460.2 Gene:npm1a / 266985 ZFINID:ZDB-GENE-021028-1 Length:279 Species:Danio rerio


Alignment Length:199 Identity:52/199 - (26%)
Similarity:80/199 - (40%) Gaps:52/199 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAEESF-YGVTLTAESDSVTWDVDEDYARGQKLVIKQILLGAEAKENEFNVVEV---NTPKDSVQ 61
            |..::| ||..|.|..|......|:||  ..:|.::...:....|: |.||||:   ::....|:
Zfish     6 MGPQTFLYGCELKAGKDITFNPEDDDY--DHQLSVRMACVDPSTKD-ELNVVEIEGQDSEGQKVK 67

  Fly    62 IPIAVLKAGETRAVNPDVEFYESKVTFKLIKGSGPVYIHGHNI---------------KDDVEVV 111
            ..:|.||.....:|..........|.|:|..|||||:|.|.::               :::.|.|
Zfish    68 AVLATLKPSTLPSVCLGGFEITPPVVFRLRTGSGPVHISGQHLVIMGGDQSFDEEEEEEEEEETV 132

  Fly   112 ---------------------------DMEEDDEEDDVAEDE-EDEHP--KKRAKIENAADGKNA 146
                                       |.|:||:|||..||| |:|.|  :|:|..:.....:|.
Zfish   133 MTSKKRPALSTPKPSKKMKMDEEDDDDDDEDDDDEDDDEEDESEEESPVKEKKAPAKPKTPTQNG 197

  Fly   147 KNNK 150
            |..|
Zfish   198 KGPK 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NlpNP_001263094.1 Nucleoplasmin 6..104 CDD:397268 31/101 (31%)
npm1aNP_955460.2 Nucleoplasmin 9..>120 CDD:281111 31/113 (27%)
NPM1-C 229..277 CDD:292893
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594262
Domainoid 1 1.000 46 1.000 Domainoid score I12094
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 60 1.000 Inparanoid score I5397
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1485080at2759
OrthoFinder 1 1.000 - - FOG0000973
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22747
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
66.090

Return to query results.
Submit another query.