DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nlp and Npm1

DIOPT Version :9

Sequence 1:NP_001263094.1 Gene:Nlp / 43560 FlyBaseID:FBgn0016685 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_037124.1 Gene:Npm1 / 25498 RGDID:3192 Length:292 Species:Rattus norvegicus


Alignment Length:194 Identity:50/194 - (25%)
Similarity:87/194 - (44%) Gaps:56/194 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YGVTLTAESDSVTWDVDEDYARGQKLVIKQILLGAEAKENEFNVVE---VNTPKDSVQIPIAVLK 68
            :|..|.|:.| ..:.||.|....| |.::.:.|||.||: |.::||   :|.....:::.:|.||
  Rat    19 FGCELKADKD-YHFKVDNDENEHQ-LSLRTVSLGAGAKD-ELHIVEAEAMNYEGSPIKVTLATLK 80

  Fly    69 AGETRAVNPDVEFYESKVT----FKLIKGSGPVYIHGHNI-------------KDDVEVVDM--- 113
                .:|.|.|.....::|    .:|..|||||:|.|.::             ::||:::.|   
  Rat    81 ----MSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGK 141

  Fly   114 ------------------EEDDEEDDVAEDEED--------EHPKKRAKIENAADGKNAKNNKK 151
                              |:|||:|:..||:||        |..:::..::.:.....|||.:|
  Rat   142 RSAPGGGNKVPQKKVKLDEDDDEDDEDDEDDEDDDDDDFDEEETEEKVPVKKSVRDTPAKNAQK 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NlpNP_001263094.1 Nucleoplasmin 6..104 CDD:397268 33/103 (32%)
Npm1NP_037124.1 Required for interaction with SENP3. /evidence=ECO:0000250 1..185 46/172 (27%)
Necessary for interaction with APEX1. /evidence=ECO:0000250 1..117 33/104 (32%)
Nucleoplasmin 18..117 CDD:397268 33/104 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 138..248 15/68 (22%)
Nuclear localization signal. /evidence=ECO:0000255 152..157 0/4 (0%)
Nuclear localization signal. /evidence=ECO:0000255 190..196 0/5 (0%)
Required for nucleolar localization. /evidence=ECO:0000250 241..292
NPM1-C 243..289 CDD:406641
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352335
Domainoid 1 1.000 45 1.000 Domainoid score I11857
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I5285
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1485080at2759
OrthoFinder 1 1.000 - - FOG0000973
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22747
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.000

Return to query results.
Submit another query.