DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nlp and Npm1

DIOPT Version :9

Sequence 1:NP_001263094.1 Gene:Nlp / 43560 FlyBaseID:FBgn0016685 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_032748.1 Gene:Npm1 / 18148 MGIID:106184 Length:292 Species:Mus musculus


Alignment Length:196 Identity:51/196 - (26%)
Similarity:87/196 - (44%) Gaps:60/196 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YGVTLTAESDSVTWDVDEDYARGQKLVIKQILLGAEAKENEFNVVE---VNTPKDSVQIPIAVLK 68
            :|..|.|:.| ..:.||.|....| |.::.:.|||.||: |.::||   :|.....:::.:|.||
Mouse    19 FGCELKADKD-YHFKVDNDENEHQ-LSLRTVSLGAGAKD-ELHIVEAEAMNYEGSPIKVTLATLK 80

  Fly    69 AGETRAVNPDVEFYESKVT----FKLIKGSGPVYIHGHNI-------------KDDVEVVDM--- 113
                .:|.|.|.....::|    .:|..|||||:|.|.::             ::||:::.|   
Mouse    81 ----MSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGK 141

  Fly   114 --------------------EEDDEEDDVAEDEED--------EHPKKRAKIENAADGKNAKNNK 150
                                :|||:|||  ||:||        |..:::..::.:.....|||.:
Mouse   142 RSAPGGGNKVPQKKVKLDEDDEDDDEDD--EDDEDDDDDDFDEEETEEKVPVKKSVRDTPAKNAQ 204

  Fly   151 K 151
            |
Mouse   205 K 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NlpNP_001263094.1 Nucleoplasmin 6..104 CDD:397268 33/103 (32%)
Npm1NP_032748.1 Required for interaction with SENP3. /evidence=ECO:0000250 1..185 47/174 (27%)
Necessary for interaction with APEX1. /evidence=ECO:0000250 1..117 33/104 (32%)
Nucleoplasmin 18..116 CDD:308605 33/103 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 138..248 16/70 (23%)
Nuclear localization signal. /evidence=ECO:0000255 152..157 0/4 (0%)
Nuclear localization signal. /evidence=ECO:0000255 190..196 0/5 (0%)
Required for nucleolar localization. /evidence=ECO:0000250 241..292
NPM1-C 243..291 CDD:318505
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848742
Domainoid 1 1.000 44 1.000 Domainoid score I12219
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I5420
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000973
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22747
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.