Sequence 1: | NP_001263094.1 | Gene: | Nlp / 43560 | FlyBaseID: | FBgn0016685 | Length: | 152 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_032748.1 | Gene: | Npm1 / 18148 | MGIID: | 106184 | Length: | 292 | Species: | Mus musculus |
Alignment Length: | 196 | Identity: | 51/196 - (26%) |
---|---|---|---|
Similarity: | 87/196 - (44%) | Gaps: | 60/196 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 YGVTLTAESDSVTWDVDEDYARGQKLVIKQILLGAEAKENEFNVVE---VNTPKDSVQIPIAVLK 68
Fly 69 AGETRAVNPDVEFYESKVT----FKLIKGSGPVYIHGHNI-------------KDDVEVVDM--- 113
Fly 114 --------------------EEDDEEDDVAEDEED--------EHPKKRAKIENAADGKNAKNNK 150
Fly 151 K 151 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Nlp | NP_001263094.1 | Nucleoplasmin | 6..104 | CDD:397268 | 33/103 (32%) |
Npm1 | NP_032748.1 | Required for interaction with SENP3. /evidence=ECO:0000250 | 1..185 | 47/174 (27%) | |
Necessary for interaction with APEX1. /evidence=ECO:0000250 | 1..117 | 33/104 (32%) | |||
Nucleoplasmin | 18..116 | CDD:308605 | 33/103 (32%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 138..248 | 16/70 (23%) | |||
Nuclear localization signal. /evidence=ECO:0000255 | 152..157 | 0/4 (0%) | |||
Nuclear localization signal. /evidence=ECO:0000255 | 190..196 | 0/5 (0%) | |||
Required for nucleolar localization. /evidence=ECO:0000250 | 241..292 | ||||
NPM1-C | 243..291 | CDD:318505 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167848742 | |
Domainoid | 1 | 1.000 | 44 | 1.000 | Domainoid score | I12219 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 57 | 1.000 | Inparanoid score | I5420 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000973 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR22747 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
6 | 5.990 |