DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nlp and NPM2

DIOPT Version :9

Sequence 1:NP_001263094.1 Gene:Nlp / 43560 FlyBaseID:FBgn0016685 Length:152 Species:Drosophila melanogaster
Sequence 2:XP_011542662.1 Gene:NPM2 / 10361 HGNCID:7930 Length:289 Species:Homo sapiens


Alignment Length:168 Identity:51/168 - (30%)
Similarity:78/168 - (46%) Gaps:29/168 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YGVTLTAESDSVTWDVDEDYARGQKLVIKQILLGAEAKENEFNVVEVNTP-----KDSVQIPIAV 66
            :|..|:.|..:.|:....:..:..:|::..|.||.:||| |.:.||:..|     |....:.||.
Human    94 HGCELSQERRTWTFRPQLEGKQSCRLLLHTICLGEKAKE-EMHRVEILPPANQEDKKMQPVTIAS 157

  Fly    67 LKAGETRAVNPDVEF----YESKVTFKLIKGSGPVYIHGHN---------IKDDVEVVDMEEDDE 118
            |:|    :|.|.|..    ....|||:|..|||||::.|..         .:::.|..:.||::|
Human   158 LQA----SVLPMVSMVGVQLSPPVTFQLRAGSGPVFLSGQERYEASDLTWEEEEEEEGEEEEEEE 218

  Fly   119 EDDVAEDE----EDEHPKKRAKIENAADGKNAKNNKKK 152
            |||..||.    |::.|.|:.|  .....|.|...|||
Human   219 EDDEDEDADISLEEQSPVKQVK--RLVPQKQASVAKKK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NlpNP_001263094.1 Nucleoplasmin 6..104 CDD:397268 33/114 (29%)
NPM2XP_011542662.1 Nucleoplasmin 95..>194 CDD:281111 33/103 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158348
Domainoid 1 1.000 47 1.000 Domainoid score I12005
eggNOG 1 0.900 - - E1_2C49J
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I5411
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1485080at2759
OrthoFinder 1 1.000 - - FOG0000973
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22747
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.