DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nlp and NPM3

DIOPT Version :9

Sequence 1:NP_001263094.1 Gene:Nlp / 43560 FlyBaseID:FBgn0016685 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_008924.1 Gene:NPM3 / 10360 HGNCID:7931 Length:178 Species:Homo sapiens


Alignment Length:126 Identity:41/126 - (32%)
Similarity:64/126 - (50%) Gaps:9/126 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FYGVTLTAESDSVTWDVDEDYARGQKLVIKQILLGAEAKENEFNVVEV---NTPKDSVQIPIAVL 67
            |:|..|:..:.|.|:.|:|:......|.:..:.| .|..::|.|||||   |.....:.:|:|.|
Human    38 FFGCELSGHTRSFTFKVEEEDDAEHVLALTMLCL-TEGAKDECNVVEVVARNHDHQEIAVPVANL 101

  Fly    68 KAGETRAVNPDVEFYESKVTFKLIKGSGPVYIHGHNIKDDVEVVDMEEDDEEDDVAEDEED 128
            |......::.|....:..|||:|..|||||.|.|.:     ::|.|..|..|::..|:|||
Human   102 KLSCQPMLSLDDFQLQPPVTFRLKSGSGPVRITGRH-----QIVTMSNDVSEEESEEEEED 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NlpNP_001263094.1 Nucleoplasmin 6..104 CDD:397268 33/100 (33%)
NPM3NP_008924.1 Nucleoplasmin 38..137 CDD:308605 33/99 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 141..178 7/17 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158350
Domainoid 1 1.000 47 1.000 Domainoid score I12005
eggNOG 1 0.900 - - E1_2C49J
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I5411
Isobase 1 0.950 - 0 Normalized mean entropy S7753
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1485080at2759
OrthoFinder 1 1.000 - - FOG0000973
OrthoInspector 1 1.000 - - oto89477
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR22747
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R11310
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.880

Return to query results.
Submit another query.