DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nlp and XB5867546

DIOPT Version :9

Sequence 1:NP_001263094.1 Gene:Nlp / 43560 FlyBaseID:FBgn0016685 Length:152 Species:Drosophila melanogaster
Sequence 2:XP_031754007.1 Gene:XB5867546 / 100495408 XenbaseID:XB-GENE-5867547 Length:134 Species:Xenopus tropicalis


Alignment Length:117 Identity:37/117 - (31%)
Similarity:60/117 - (51%) Gaps:7/117 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YGVTLTAESDSVTWDVDEDYARGQKLVIKQILLGAEAKENEFNVVEVNTPK-DSVQIPIAVLKAG 70
            :|..|:.:..:..::.::|:.. ..|.:..|.||||.|: |.|||.....: ....|.||.|:..
 Frog    23 WGCVLSKDDKTYVFEPEDDFLE-HLLELWTICLGAETKD-ETNVVAAELRQTQGKPITIASLRPS 85

  Fly    71 ETRAVNPDVEFYESKVTFKLIKGSGPVYIHGHNIKDDVEVVDMEEDDEEDDV 122
            ....:|.:...:.:.|||.|..|||||||.|.:|    .:||..||:.::|:
 Frog    86 VLPMINVNGLEFSTPVTFTLKSGSGPVYISGIHI----SLVDDGEDETQEDL 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NlpNP_001263094.1 Nucleoplasmin 6..104 CDD:397268 31/97 (32%)
XB5867546XP_031754007.1 Nucleoplasmin 23..119 CDD:397268 31/97 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1485080at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.