DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nph and npm2a

DIOPT Version :9

Sequence 1:NP_001097975.1 Gene:Nph / 43559 FlyBaseID:FBgn0039735 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001186842.1 Gene:npm2a / 797865 ZFINID:ZDB-GENE-060810-57 Length:156 Species:Danio rerio


Alignment Length:136 Identity:42/136 - (30%)
Similarity:60/136 - (44%) Gaps:22/136 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YGVTLSEKEAIAQFEVPDVPEEYIVHSHKLIIKQISLGPEAKTGEFNVVQAETNINDDGEKKTLK 71
            :|..||..:..|.|:.     |..:..::..||.|.|..:| ..|.::|..     .||...:..
Zfish    37 WGCVLSGSKTTAVFKA-----ENDLLENQFFIKTICLSEDA-GDEMHIVAV-----CDGVGASKP 90

  Fly    72 IPIAVLKVGETRSLRPNVEFPN----GSVTFKLVQGSGPVHVCGK-VEMNFGEFDDGQIYEEYSD 131
            :|||.|     |...|.:.||.    ..|||||..|.|||.|..: :.:|..|..:.: .||..|
Zfish    91 LPIATL-----RHCMPMISFPGLELIPPVTFKLCSGKGPVFVSAQHITLNPIEMIEEE-EEEKQD 149

  Fly   132 EEEDSE 137
            ||||.:
Zfish   150 EEEDED 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NphNP_001097975.1 Nucleoplasmin 6..112 CDD:397268 33/108 (31%)
npm2aNP_001186842.1 Nucleoplasmin 37..132 CDD:308605 33/110 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594267
Domainoid 1 1.000 46 1.000 Domainoid score I12094
eggNOG 1 0.900 - - E1_2C49J
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 60 1.000 Inparanoid score I5397
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000973
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22747
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.