DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nph and npm1b

DIOPT Version :9

Sequence 1:NP_001097975.1 Gene:Nph / 43559 FlyBaseID:FBgn0039735 Length:156 Species:Drosophila melanogaster
Sequence 2:XP_005173145.2 Gene:npm1b / 553507 ZFINID:ZDB-GENE-080723-7 Length:316 Species:Danio rerio


Alignment Length:166 Identity:47/166 - (28%)
Similarity:76/166 - (45%) Gaps:42/166 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YGVTLSEKEAIAQFEVPDVPEEYIVHSHKLIIKQISLGPEAKTGEFNVVQAETNINDDGEKKTLK 71
            :|.:|...:...:.::.|...|     |:|.:|.:.||.||: .:|:.|:.| .:..||  ||.|
Zfish    33 FGCSLKADKKEHKVDLDDDEAE-----HQLSLKSVCLGAEAE-DKFHTVEME-GLTYDG--KTTK 88

  Fly    72 IPIAVLKVGETRSLRPNVEFPNGSVT----FKLVQGSGPVHVCGKVEMNFGEFDDGQIYEEY--- 129
            |.:||||    .|:.|::......||    |:|..|.|||::.|:..::..|.||....||.   
Zfish    89 ITLAVLK----PSVLPSLSLGGFEVTPPVSFRLQSGGGPVYISGQHFVSVKESDDEDEEEEENNT 149

  Fly   130 ----------------------SDEEEDSELEFDEE 143
                                  |||:|||:.:.|::
Zfish   150 SPVKRPSNMTLAKVPQKKLKMDSDEDEDSDDDDDDD 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NphNP_001097975.1 Nucleoplasmin 6..112 CDD:397268 34/108 (31%)
npm1bXP_005173145.2 Nucleoplasmin 32..131 CDD:308605 35/110 (32%)
NPM1-C 265..313 CDD:318505
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594269
Domainoid 1 1.000 46 1.000 Domainoid score I12094
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 60 1.000 Inparanoid score I5397
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1485080at2759
OrthoFinder 1 1.000 - - FOG0000973
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_111063
Panther 1 1.100 - - O PTHR22747
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.