DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nph and npm3

DIOPT Version :9

Sequence 1:NP_001097975.1 Gene:Nph / 43559 FlyBaseID:FBgn0039735 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001016456.1 Gene:npm3 / 549210 XenbaseID:XB-GENE-954429 Length:177 Species:Xenopus tropicalis


Alignment Length:167 Identity:53/167 - (31%)
Similarity:84/167 - (50%) Gaps:31/167 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ESF-YGVTLSEKEAIAQFEVPDVPEEYIVHSHKLIIKQISLGPEAKTGEFNVVQAETNINDDGEK 67
            ||: :|..||.|.....|:|.:..:.    ||.:.::.||||..|| .|.|||:...:...|   
 Frog    18 ESYLFGCELSSKTKQYTFQVDEEDDA----SHCVCLQTISLGAGAK-DEHNVVEVTAHNYQD--- 74

  Fly    68 KTLKIPIAVLKVGETRSLRP--NVEF----PNGSVTFKLVQGSGPVHVCGK--------VEMNFG 118
            |.:.:|:|.||:    |.:|  |||:    |  .|||:|..|||||.:.|:        ::::..
 Frog    75 KEVTVPLANLKL----SCQPMVNVEYFEIEP--PVTFRLTSGSGPVFISGRHYIVINDDIDLSGS 133

  Fly   119 EFDDGQIYEEYSDEEEDSELEFDEEAAPQTNGKSNKK 155
            :.||..  |:..|:::|.:.:.:||....|..|..||
 Frog   134 DEDDDD--EDIDDDDDDDDDDDEEEEEVVTPIKPAKK 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NphNP_001097975.1 Nucleoplasmin 6..112 CDD:397268 39/112 (35%)
npm3NP_001016456.1 Nucleoplasmin 18..>129 CDD:281111 42/124 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10665
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I5031
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1485080at2759
OrthoFinder 1 1.000 - - FOG0000973
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR22747
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.