DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nph and Nlp

DIOPT Version :9

Sequence 1:NP_001097975.1 Gene:Nph / 43559 FlyBaseID:FBgn0039735 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001263094.1 Gene:Nlp / 43560 FlyBaseID:FBgn0016685 Length:152 Species:Drosophila melanogaster


Alignment Length:168 Identity:75/168 - (44%)
Similarity:99/168 - (58%) Gaps:28/168 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MESESFYGVTL-SEKEAIAQFEVPDVPEEYIVHSHKLIIKQISLGPEAKTGEFNVVQAETNINDD 64
            |..|||||||| :|.:::..    ||.|:| ....||:||||.||.|||..|||||:..|     
  Fly     1 MAEESFYGVTLTAESDSVTW----DVDEDY-ARGQKLVIKQILLGAEAKENEFNVVEVNT----- 55

  Fly    65 GEKKTLKIPIAVLKVGETRSLRPNVEFPNGSVTFKLVQGSGPVHVCGKVEMNFGEFDDGQIYEEY 129
             .|.:::|||||||.||||::.|:|||....|||||::|||||::.|.   |..  ||.::.:..
  Fly    56 -PKDSVQIPIAVLKAGETRAVNPDVEFYESKVTFKLIKGSGPVYIHGH---NIK--DDVEVVDME 114

  Fly   130 SDEEEDSELEFDEE-----------AAPQTNGKSNKKK 156
            .|:|||...|.:|:           ||...|.|:||||
  Fly   115 EDDEEDDVAEDEEDEHPKKRAKIENAADGKNAKNNKKK 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NphNP_001097975.1 Nucleoplasmin 6..112 CDD:397268 54/106 (51%)
NlpNP_001263094.1 Nucleoplasmin 6..104 CDD:397268 55/111 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450317
Domainoid 1 1.000 46 1.000 Domainoid score I12094
eggNOG 1 0.900 - - E1_2C49J
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 60 1.000 Inparanoid score I5397
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27157
OrthoDB 1 1.010 - - D1485080at2759
OrthoFinder 1 1.000 - - FOG0000973
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22747
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.910

Return to query results.
Submit another query.