DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nph and npm1

DIOPT Version :9

Sequence 1:NP_001097975.1 Gene:Nph / 43559 FlyBaseID:FBgn0039735 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_988883.1 Gene:npm1 / 394478 XenbaseID:XB-GENE-1019571 Length:304 Species:Xenopus tropicalis


Alignment Length:215 Identity:57/215 - (26%)
Similarity:83/215 - (38%) Gaps:84/215 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YGVTLSEKEAIAQFEVPDVPEEYIVHSHKLIIKQISLGPEAKTGEFNVVQAETNINDDGEKKTLK 71
            :|..|...:....|:|.|...|     |:|.::.:|:|..|| .|.:||:|| .||.:|  ||:|
 Frog    20 FGCELKADKREYSFKVEDDENE-----HQLSLRTVSVGASAK-DELHVVEAE-GINYEG--KTIK 75

  Fly    72 IPIAVLKVGETRSLRPNVEFPNGSVT----FKLVQGSGPVHVCG--------------------- 111
            |.:|.||    .|::|.|......:|    .:|..|||||:|.|                     
 Frog    76 ITLASLK----PSVQPTVSLGGFEITPPVILRLKSGSGPVYVSGQHLVALEDLESTDDEDEEHDV 136

  Fly   112 ---------------KV-----------EMNFGEFDDGQIYEEYSDEEEDSELEFDEEAAP---- 146
                           ||           |.:..|.||    ::..|||||.|.|.:|:..|    
 Frog   137 PSPKNAKRTASDAASKVPRKKTRLEEEDEADSDEDDD----DDDDDEEEDDEDEDEEDETPVKKT 197

  Fly   147 ------------QTNGKSNK 154
                        ..|||:::
 Frog   198 DLPTKPKAAQKLNHNGKASE 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NphNP_001097975.1 Nucleoplasmin 6..112 CDD:397268 39/144 (27%)
npm1NP_988883.1 Nucleoplasmin 19..118 CDD:367319 39/110 (35%)
NPM1-C 251..295 CDD:374465
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10665
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I5031
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1485080at2759
OrthoFinder 1 1.000 - - FOG0000973
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22747
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.