Sequence 1: | NP_001097975.1 | Gene: | Nph / 43559 | FlyBaseID: | FBgn0039735 | Length: | 156 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_988883.1 | Gene: | npm1 / 394478 | XenbaseID: | XB-GENE-1019571 | Length: | 304 | Species: | Xenopus tropicalis |
Alignment Length: | 215 | Identity: | 57/215 - (26%) |
---|---|---|---|
Similarity: | 83/215 - (38%) | Gaps: | 84/215 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 YGVTLSEKEAIAQFEVPDVPEEYIVHSHKLIIKQISLGPEAKTGEFNVVQAETNINDDGEKKTLK 71
Fly 72 IPIAVLKVGETRSLRPNVEFPNGSVT----FKLVQGSGPVHVCG--------------------- 111
Fly 112 ---------------KV-----------EMNFGEFDDGQIYEEYSDEEEDSELEFDEEAAP---- 146
Fly 147 ------------QTNGKSNK 154 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Nph | NP_001097975.1 | Nucleoplasmin | 6..112 | CDD:397268 | 39/144 (27%) |
npm1 | NP_988883.1 | Nucleoplasmin | 19..118 | CDD:367319 | 39/110 (35%) |
NPM1-C | 251..295 | CDD:374465 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 57 | 1.000 | Domainoid score | I10665 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 82 | 1.000 | Inparanoid score | I5031 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1485080at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000973 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR22747 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
6 | 6.070 |