DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nph and Npm2

DIOPT Version :9

Sequence 1:NP_001097975.1 Gene:Nph / 43559 FlyBaseID:FBgn0039735 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_851990.2 Gene:Npm2 / 328440 MGIID:1890811 Length:207 Species:Mus musculus


Alignment Length:166 Identity:47/166 - (28%)
Similarity:77/166 - (46%) Gaps:30/166 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YGVTLSEKEAIAQFEVPDVPEEYIVHSHKLIIKQISLGPEAKTGEFNVVQAETNINDDGEKKTLK 71
            :|..|::::....|......::    |.||::..|.||.:||. |.|.|:.   ::.:|.|.  .
Mouse    19 WGSELNQEKQTCTFRGQGEKKD----SCKLLLSTICLGEKAKE-EVNRVEV---LSQEGRKP--P 73

  Fly    72 IPIAVLKVGETRSLRPNVEFP----NGSVTFKLVQGSGPVHVCG-----KVEMNFGEFDDGQIYE 127
            |.||.||.    |:.|.|...    :..|||:|..|||||.:.|     ..::.:.:.::.:..|
Mouse    74 ITIATLKA----SVLPMVTVSGIELSPPVTFRLRTGSGPVFLSGLECYETSDLTWEDDEEEEEEE 134

  Fly   128 EYSDEEEDSELEFDE-------EAAPQTNGKSNKKK 156
            |..||:||:::..:|       ..|||......|||
Mouse   135 EEEDEDEDADISLEEIPVKQVKRVAPQKQMSIAKKK 170

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
NphNP_001097975.1 Nucleoplasmin 6..112 CDD:397268 34/113 (30%)