DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nph and CG43902

DIOPT Version :9

Sequence 1:NP_001097975.1 Gene:Nph / 43559 FlyBaseID:FBgn0039735 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_572608.2 Gene:CG43902 / 31948 FlyBaseID:FBgn0264503 Length:1220 Species:Drosophila melanogaster


Alignment Length:130 Identity:30/130 - (23%)
Similarity:49/130 - (37%) Gaps:38/130 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 NDDGEKK-------TLKIP--IAVLKVGE----------TRSLRPNVEFPNGSVTFKLVQGSGPV 107
            ||:..||       |.|:|  :|..|...          |.:.......|:.|.|  ..:...|.
  Fly   396 NDELAKKYPVATSTTTKVPTTLATSKTTSRSSSSSTTTTTMATSTTATSPSPSTT--TTKPRTPT 458

  Fly   108 HVCG-KVEMNF-----------GEFDDGQIYEEYSDEEEDSELEFDEEAAP----QTNGKSNKKK 156
            ...| |::.||           |.:|.|:|..: :.|::.:|.:.||....    .|:|.|:.:|
  Fly   459 PTIGRKLKRNFFGLSQPETRYYGSYDIGRIRAQ-TQEDDTTEEKKDENVGELHYYDTSGGSSSRK 522

  Fly   157  156
              Fly   523  522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NphNP_001097975.1 Nucleoplasmin 6..112 CDD:397268 15/69 (22%)
CG43902NP_572608.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22747
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.