DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nph and Npm3

DIOPT Version :9

Sequence 1:NP_001097975.1 Gene:Nph / 43559 FlyBaseID:FBgn0039735 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_032749.1 Gene:Npm3 / 18150 MGIID:894653 Length:175 Species:Mus musculus


Alignment Length:141 Identity:43/141 - (30%)
Similarity:65/141 - (46%) Gaps:23/141 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FYGVTLSEKEAIAQFEVPDVPEEYIVHSHKLIIKQISLGPEAKTGEFNVVQAETNINDDGEKKTL 70
            |:|..||.......|:|    ||.....|.|.:..:.| .|..|.|.|||:.....:|:.|   :
Mouse    38 FFGCELSGHTRSFTFKV----EEEDDTEHVLALNMLCL-TEGATDECNVVEVVARDHDNQE---I 94

  Fly    71 KIPIAVLKVGETRSLRPNVEFPN----GSVTFKLVQGSGPVHVCGKVEMNFGEFDDGQIYEEYSD 131
            .:|:|.|::    |.:|.:...:    ..|||:|..|||||.:.|:.::..       |..:.|:
Mouse    95 AVPVANLRL----SCQPMLSVDDFQLQPPVTFRLKSGSGPVRITGRHQIVC-------INNDLSE 148

  Fly   132 EEEDSELEFDE 142
            ||.|.|.|.||
Mouse   149 EESDDESEEDE 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NphNP_001097975.1 Nucleoplasmin 6..112 CDD:397268 33/109 (30%)
Npm3NP_032749.1 Nucleoplasmin 35..>141 CDD:281111 34/114 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848747
Domainoid 1 1.000 44 1.000 Domainoid score I12219
eggNOG 1 0.900 - - E1_2C49J
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I5420
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1485080at2759
OrthoFinder 1 1.000 - - FOG0000973
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR22747
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.