DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nph and NPM2

DIOPT Version :9

Sequence 1:NP_001097975.1 Gene:Nph / 43559 FlyBaseID:FBgn0039735 Length:156 Species:Drosophila melanogaster
Sequence 2:XP_011542662.1 Gene:NPM2 / 10361 HGNCID:7930 Length:289 Species:Homo sapiens


Alignment Length:174 Identity:48/174 - (27%)
Similarity:76/174 - (43%) Gaps:37/174 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YGVTLSEKEAIAQFEVPDVPEEYIVHSHKLIIKQISLGPEAKTGEFNVVQAETNINDDGEKKTLK 71
            :|..||::.....|.    |:.....|.:|::..|.||.:||. |.:.|:.....|.: :||...
Human    94 HGCELSQERRTWTFR----PQLEGKQSCRLLLHTICLGEKAKE-EMHRVEILPPANQE-DKKMQP 152

  Fly    72 IPIAVLKVGETRSLRPNVEFP----NGSVTFKLVQGSGPVHVCG------------KVEMNFGEF 120
            :.||.|:.    |:.|.|...    :..|||:|..|||||.:.|            :.|...||.
Human   153 VTIASLQA----SVLPMVSMVGVQLSPPVTFQLRAGSGPVFLSGQERYEASDLTWEEEEEEEGEE 213

  Fly   121 DDGQIYEEYSDEEEDSELEFDEEA--------APQTNGKSNKKK 156
            ::   .||..||:||:::..:|::        .||......|||
Human   214 EE---EEEEDDEDEDADISLEEQSPVKQVKRLVPQKQASVAKKK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NphNP_001097975.1 Nucleoplasmin 6..112 CDD:397268 33/120 (28%)
NPM2XP_011542662.1 Nucleoplasmin 95..>194 CDD:281111 33/108 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158349
Domainoid 1 1.000 47 1.000 Domainoid score I12005
eggNOG 1 0.900 - - E1_2C49J
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I5411
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1485080at2759
OrthoFinder 1 1.000 - - FOG0000973
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22747
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.