DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nph and NPM3

DIOPT Version :9

Sequence 1:NP_001097975.1 Gene:Nph / 43559 FlyBaseID:FBgn0039735 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_008924.1 Gene:NPM3 / 10360 HGNCID:7931 Length:178 Species:Homo sapiens


Alignment Length:148 Identity:46/148 - (31%)
Similarity:67/148 - (45%) Gaps:25/148 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FYGVTLSEKEAIAQFEVPDVPEEYIVHSHKLIIKQISLGPEAKTGEFNVVQAETNINDDGEKKTL 70
            |:|..||.......|:|    ||.....|.|.:..:.|...|| .|.|||:.....:|..|   :
Human    38 FFGCELSGHTRSFTFKV----EEEDDAEHVLALTMLCLTEGAK-DECNVVEVVARNHDHQE---I 94

  Fly    71 KIPIAVLKVGETRSLRPNVEFPN----GSVTFKLVQGSGPVHVCGK---VEMNFGEFDDGQIYEE 128
            .:|:|.||:    |.:|.:...:    ..|||:|..|||||.:.|:   |.|:      ..:.||
Human    95 AVPVANLKL----SCQPMLSLDDFQLQPPVTFRLKSGSGPVRITGRHQIVTMS------NDVSEE 149

  Fly   129 YSDEEEDSELEFDEEAAP 146
            .|:|||:...|.:.|..|
Human   150 ESEEEEEDSDEEEVELCP 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NphNP_001097975.1 Nucleoplasmin 6..112 CDD:397268 34/109 (31%)
NPM3NP_008924.1 Nucleoplasmin 38..137 CDD:308605 35/110 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 141..178 10/33 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158351
Domainoid 1 1.000 47 1.000 Domainoid score I12005
eggNOG 1 0.900 - - E1_2C49J
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I5411
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1485080at2759
OrthoFinder 1 1.000 - - FOG0000973
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR22747
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.