DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tace and CG34298

DIOPT Version :9

Sequence 1:NP_733334.1 Gene:Tace / 43558 FlyBaseID:FBgn0039734 Length:732 Species:Drosophila melanogaster
Sequence 2:NP_001097976.1 Gene:CG34298 / 5740436 FlyBaseID:FBgn0085327 Length:139 Species:Drosophila melanogaster


Alignment Length:146 Identity:28/146 - (19%)
Similarity:54/146 - (36%) Gaps:22/146 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 FRAYAVDADGNETVVHMDHDSFYSGRVFGELESSVRAHIEDGTMTMSIHLPEETYHIEPSWRHLP 154
            |.::.|..|.|:.:...            :.|...|...||.:....:|||:..:.:.||:::..
  Fly     9 FTSWPVKFDINQLIKEF------------QPEEKGRQVDEDKSPRDFLHLPDNNWVVLPSFKYQF 61

  Fly   155 EAKKDTMVAYKASDVKVH-KNEAGATPKTCGYIKEGLELEDKEHGDTLDNELHTREKRQSDQYEY 218
            |.....:...::..::.. :......|.:  |:...|      :|..:.|....|.|..:.|: |
  Fly    62 EHLTPYLSCRQSKYMRCRFQKFLDNVPSS--YVTISL------YGSNVSNMPKPRRKSLNGQF-Y 117

  Fly   219 TPTKTRCPLLLVADYR 234
            .......|:..|||.|
  Fly   118 GVDNKLAPVPAVADPR 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TaceNP_733334.1 Pep_M12B_propep 50..162 CDD:279848 14/71 (20%)
ZnMc_TACE_like 223..470 CDD:239798 5/12 (42%)
Reprolysin_2 244..456 CDD:290307
Disintegrin 477..552 CDD:278623
ADAM17_MPD 576..633 CDD:271205
CG34298NP_001097976.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3658
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.