DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tace and F27D9.7

DIOPT Version :10

Sequence 1:NP_733334.1 Gene:Tace / 43558 FlyBaseID:FBgn0039734 Length:732 Species:Drosophila melanogaster
Sequence 2:NP_509295.3 Gene:F27D9.7 / 185019 WormBaseID:WBGene00017865 Length:386 Species:Caenorhabditis elegans


Alignment Length:216 Identity:51/216 - (23%)
Similarity:75/216 - (34%) Gaps:71/216 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   303 NMIREKWDVRNLLEVFSREYSHKDFCLAHLFTDL---KFEGGILGLAYVGSPRRNSVGGICTPEY 364
            :.|..|.:.:||:|              |..|.|   .:||||   ||        ..|||:   
 Worm   109 DFISWKKEQQNLIE--------------HDVTVLLRHNYEGGI---AY--------SNGICS--- 145

  Fly   365 FKNGYTLYLNSGLSSSRNHYGQRVITREADLVTAHEFGHNWGSEHDPDIPECSPSASQGGSFLMY 429
             ||  :|.::..|..:         |.....|..|:..|..|..|... .:|..:.:..|..|  
 Worm   146 -KN--SLMISGFLPDA---------TMNNAWVFMHQLAHVIGLTHKQQ-TKCECNTAINGRCL-- 195

  Fly   430 TYSVSGYDVNNKKFSPCSLRSIRKVLQAKSGRCFSEPEESF--------------CGNLRVEGDE 480
              .:||       |..||::.:  |.:..:..|..:...||              |||...|.:|
 Worm   196 --KLSG-------FPECSVQEM--VDKLSNSSCL
IQESPSFAKNTVVPKKGSLPVCGNGLQEDEE 249

  Fly   481 QCDAGLLGTEDNDSCCDKNCK 501
            :||.|.....||..|....|:
 Worm   250 ECDCGPERFCDNILCDAVKCR 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TaceNP_733334.1 Pep_M12B_propep 44..164 CDD:460254
ZnMc_TACE_like 223..470 CDD:239798 37/169 (22%)
Disintegrin 477..552 CDD:459709 9/25 (36%)
ADAM17_MPD 576..633 CDD:271205
F27D9.7NP_509295.3 Reprolysin 56..218 CDD:426256 36/162 (22%)
Disintegrin 246..>272 CDD:471982 9/25 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.