DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11504 and CG42526

DIOPT Version :9

Sequence 1:NP_651758.1 Gene:CG11504 / 43557 FlyBaseID:FBgn0039733 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001163401.1 Gene:CG42526 / 8674075 FlyBaseID:FBgn0260431 Length:245 Species:Drosophila melanogaster


Alignment Length:246 Identity:45/246 - (18%)
Similarity:85/246 - (34%) Gaps:66/246 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 NIPINELEKKFHTLRTQYHREISRMKRKEPYNSKWFGFKNLVFLSSPYACRSTKGRLKADLQGDE 113
            |:.|.|   |:||          |..||:            .:::...||:.:....:...:...
  Fly    15 NVSIFE---KYHT----------RYDRKQ------------AWIAVAQACQKSVEYCQIRWKSLR 54

  Fly   114 RKFVLGEVTADHNSDSSTPANHNSNTNANMNEEYLRK--------NHASSRAQELEKLIEETTKD 170
            .::|         .::..||...||.......::||:        |...:.....:.|:...|.|
  Fly    55 DRYV---------RETQKPAATRSNIRKFKELDFLREHIRIRRKPNELCNTLNTNKTLVPGVTVD 110

  Fly   171 VDDIDESELEEGEVKPKQAKEMSVRFVSLNEQEETEPLENHHQTLMDLHHQGNAVEAVSFQA--N 233
            ....||..||...:...|..|..:.:  ..|:|.....:|            ::.|.:|..:  |
  Fly   111 SQSADELALERNGITEFQPDEFIIEY--KGEEEYLSETDN------------SSAEFISEDSACN 161

  Fly   234 ESGELHYQTTPT------QSTGSSSVHVMPTRIIKIQRRDTSSGQEDSYFE 278
            ...||.|.|.|:      ..|.:..:.||  .:|:...:|..:..:|.:::
  Fly   162 IGSELPYVTKPSFNGEGQSQTQAKFMSVM--NLIESALKDKPAEPQDPFYK 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11504NP_651758.1 MADF_DNA_bdg 11..92 CDD:287510 9/42 (21%)
CytochromB561_N 238..>409 CDD:286826 10/47 (21%)
CG42526NP_001163401.1 MADF 8..85 CDD:214738 18/103 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003392
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.