DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11504 and zgc:152938

DIOPT Version :9

Sequence 1:NP_651758.1 Gene:CG11504 / 43557 FlyBaseID:FBgn0039733 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001070756.1 Gene:zgc:152938 / 768145 ZFINID:ZDB-GENE-061013-458 Length:292 Species:Danio rerio


Alignment Length:235 Identity:54/235 - (22%)
Similarity:96/235 - (40%) Gaps:40/235 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 WTREKTLQLISEYRSRRGLWDMTCDEYRKKDVKQRLLNEVSQVLGGNIPINELEKKFHTLRTQYH 67
            |.|.....|||....||.|:|....:|:..|.::.|..|:::.:|  ..:::::.|:..||..|.
Zfish    52 WRRMDVEGLISLVSDRRELFDQNHIDYKHIDKREALWQEIAEKIG--FHVDDVKTKWKNLRDTYI 114

  Fly    68 REISRMKRKE-------PYNSK-WFGFKNLVFLSSPYACRSTKGRLK--ADLQGDERKFVLGEVT 122
            |:    ||::       |...| |...|.:.||::....|.....:|  ||..||..:.......
Zfish   115 RK----KREDQCTGEQTPKKKKTWKFMKMMEFLATSSEQRRVHSSVKESADEVGDGSESEKSLSI 175

  Fly   123 ADHNSDSSTPANHNS-NTNANMNEEYLRKNHASSRAQELEKLIEETTKD--VDDIDESELEEGEV 184
            :..::.||.|...|| ....::..:::.|..|:...::.|:  ||..|.  .|||....:....|
Zfish   176 SVESAVSSEPVQANSKKRKRSVTPDFVEKYLAAKEVRDRER--EECRKQRMEDDISLFLMSLAPV 238

  Fly   185 ----KPKQAKEMSVRFVSLNEQEETEPLENHHQTLMDLHH 220
                .|.:...:.:||               ||.|.::.:
Zfish   239 IRRLPPSKQSSVKMRF---------------HQVLHEVEY 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11504NP_651758.1 MADF_DNA_bdg 11..92 CDD:287510 23/88 (26%)
CytochromB561_N 238..>409 CDD:286826
zgc:152938NP_001070756.1 MADF_DNA_bdg 60..128 CDD:287510 19/73 (26%)
BESS 226..260 CDD:281011 10/48 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.