DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11504 and si:ch211-207i20.3

DIOPT Version :9

Sequence 1:NP_651758.1 Gene:CG11504 / 43557 FlyBaseID:FBgn0039733 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_683419.5 Gene:si:ch211-207i20.3 / 555734 ZFINID:ZDB-GENE-141222-71 Length:263 Species:Danio rerio


Alignment Length:187 Identity:48/187 - (25%)
Similarity:84/187 - (44%) Gaps:26/187 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EKTLQLISEYRSRRGLWDMTCDEYRKKDVKQRLLNEVSQVLGGNIPINELEKKFHTLRTQYHR-- 68
            |..|.|:||   .:.|:|....||:....|:.|...::..:|  :.:.|::.|:..||..|.|  
Zfish    33 ELLLFLVSE---NKELFDKNHSEYKNTKRKEALWQGIADKMG--VDVEEVKAKWKNLRDTYTRKK 92

  Fly    69 ----EISRMKRKEPYNSKWFGFKNLVFLSSPYACRSTKGRLKADLQGDERKFVLGEVTADHNSDS 129
                :.||..|......:|...:.:.||......||  |.|.:.::.||         .|.:| .
Zfish    93 RLEQDGSRSGRAAKKKKQWKYMRVMDFLDPATEHRS--GILDSKIEDDE---------PDEDS-G 145

  Fly   130 STPANHNSNTNANMNEEYLRKNHASSRAQELEKLIEE--TTKDVDDIDESELEEGEV 184
            :.||:.::.|:.. :.|.:|.:....|..|..:|:|:  .|||..|.::.|.::.||
Zfish   146 AEPASTSTGTSVT-SPEAMRSSIVKRRRSETLELLEKYLATKDAKDREKDEQQQDEV 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11504NP_651758.1 MADF_DNA_bdg 11..92 CDD:287510 20/86 (23%)
CytochromB561_N 238..>409 CDD:286826
si:ch211-207i20.3XP_683419.5 MADF 35..122 CDD:214738 23/91 (25%)
BESS 199..233 CDD:308542 2/3 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.