DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11504 and jigr1

DIOPT Version :9

Sequence 1:NP_651758.1 Gene:CG11504 / 43557 FlyBaseID:FBgn0039733 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001097920.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster


Alignment Length:385 Identity:69/385 - (17%)
Similarity:130/385 - (33%) Gaps:135/385 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TREKTLQLISEYRSRRGLWDMTCDEYRKKDVKQRLLNEVSQVLGGNIPINELEKKFHTLRTQYHR 68
            |.|..|.||.||||...|:|.:...::.|.....:..:::..||  .....:.::..|||.:|:.
  Fly    26 TGEFDLGLIREYRSHPVLYDRSNKRFKDKLYVAHIWEQIAHKLG--YDATSIRERMTTLRNRYNI 88

  Fly    69 EISRMKR-KEPYNSKWFGFKNLVFLSSPYACRSTKGRLKADLQGDERKFVLGEVTADHNSDSSTP 132
            |..|::. ....:|:|..|::|.||......|.:...:... :.||..:.:.:..:|.|      
  Fly    89 EKRRVENGLSTQSSQWPLFESLQFLGDHIRPRRSFKNMSVK-EEDEETYEVDDCRSDSN------ 146

  Fly   133 ANHNSNTNANMNEEYLRKNHASSRAQELEKLIEETTKDVDDIDESELEEGEVKPKQAKEM-SVRF 196
                              .|.:|...|||             |:||:.:.|    ||..: :|..
  Fly   147 ------------------GHMNSIKDELE-------------DDSEIFDCE----QALPVTTVLG 176

  Fly   197 VSLNEQEETEPLENHHQTLMDLHHQGNAVEAVSFQANESGEL-------HYQTTPTQSTGSSSVH 254
            :.||                      |:.||...|.:.:||:       |:..:..:...:...:
  Fly   177 IPLN----------------------NSDEANKSQRSTNGEMPNGKGYNHFAESYHRRHQNQPEY 219

  Fly   255 VMPTRIIKIQRRDTSSGQEDSYFEEHTQLHPPPVKRMYYEASPASHNTTSILSPALESSANGTAS 319
            ::.:.|:...|.:....|   :.::|     |..:|:....|.:.:..|..|:|           
  Fly   220 IISSPIVNPMRSNKRGSQ---HLDDH-----PSKRRVDDSLSISGYYPTQPLAP----------- 265

  Fly   320 SVLTTSPGITMSNLRLPKVNTPPKPAQAQAIPSPPPPTIVSLPPARDEFATYGEYVANEM 379
                                                     ||||..:|..:||::.:.:
  Fly   266 -----------------------------------------LPPAYAKFRGFGEFMCHSL 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11504NP_651758.1 MADF_DNA_bdg 11..92 CDD:287510 21/81 (26%)
CytochromB561_N 238..>409 CDD:286826 18/149 (12%)
jigr1NP_001097920.1 MADF 33..118 CDD:214738 23/86 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003392
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.