DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11504 and CG6276

DIOPT Version :10

Sequence 1:NP_651758.1 Gene:CG11504 / 43557 FlyBaseID:FBgn0039733 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_650445.3 Gene:CG6276 / 41855 FlyBaseID:FBgn0038316 Length:470 Species:Drosophila melanogaster


Alignment Length:53 Identity:11/53 - (20%)
Similarity:23/53 - (43%) Gaps:1/53 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EALRQEAETLKNAIRDARKAACDTSLVQATNNLEPIGRIQMRTRRTLRGHLAK 57
            |.|:.:||.....|:.......:...:.|..: .|..:|:.:.::.|||...:
  Fly   117 EILQYQAEKRSGCIKSTHSPTSEEMYIAAVKD-NPYPQIKSKKQKALRGRFPR 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11504NP_651758.1 MADF_DNA_bdg 11..92 CDD:463144 9/47 (19%)
CG6276NP_650445.3 MADF 32..116 CDD:214738
BESS 431..465 CDD:460758
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.