DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11504 and Mes2

DIOPT Version :9

Sequence 1:NP_651758.1 Gene:CG11504 / 43557 FlyBaseID:FBgn0039733 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_730768.1 Gene:Mes2 / 40514 FlyBaseID:FBgn0037207 Length:437 Species:Drosophila melanogaster


Alignment Length:281 Identity:65/281 - (23%)
Similarity:100/281 - (35%) Gaps:65/281 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LQLISEYRSRRGLWDMTCDEYR-KKDVKQRLLNEVSQVLGGNIPINELEKKFHTLRTQYHREISR 72
            |:||........|||.....:: .::.|.|....:.:..  |.|...:.:.|.:||..|.||::.
  Fly    61 LKLIQMVHDNPILWDSRLPNFKGAEEEKNRAWEHIGREF--NAPGRRVARAFKSLRESYRRELAH 123

  Fly    73 MK-RKEPYNSKWFGFKNLVFLSSPYACRSTKGRLKADLQGDERKFVLGEVTADHNSD-SSTPANH 135
            :| ....:..||..::.:.||..  ..|..||                   |.|.:| |.|...|
  Fly   124 VKLMGNGFKPKWSLYEAMDFLRD--VIRERKG-------------------ASHATDLSLTTYGH 167

  Fly   136 -NSNTNANMNEEYLRKNHASSRAQELEKLIEETTKDVDDIDESELEEGEVKPKQAKEMSVRFVSL 199
             |:|.|.|.|...|.   |..:|..| ||.....:....::.|:..                 ||
  Fly   168 INNNNNNNNNSNSLA---AGGKAMTL-KLSNSFNESASVLNLSKCS-----------------SL 211

  Fly   200 NEQEETEPLENHHQTLMDLHHQGNAVEAVSFQANESGELHYQTTPTQSTGSSSVHVMPTRIIKIQ 264
            |..::....:.:.:..:||...|.|..:.|..::..|.|   ..|.....:.| .|..||  ..|
  Fly   212 NVSDDHYYCDYYVKPELDLSVGGGAGSSTSGSSSGGGPL---PLPAHQAHNDS-RVSSTR--NEQ 270

  Fly   265 RR---------DTS--SGQED 274
            |.         |:|  ||.||
  Fly   271 RAQHHSYEDMDDSSIRSGDED 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11504NP_651758.1 MADF_DNA_bdg 11..92 CDD:287510 18/82 (22%)
CytochromB561_N 238..>409 CDD:286826 14/48 (29%)
Mes2NP_730768.1 MADF 62..149 CDD:214738 20/90 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.