DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11504 and CG8765

DIOPT Version :9

Sequence 1:NP_651758.1 Gene:CG11504 / 43557 FlyBaseID:FBgn0039733 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_649141.1 Gene:CG8765 / 40147 FlyBaseID:FBgn0036900 Length:690 Species:Drosophila melanogaster


Alignment Length:430 Identity:86/430 - (20%)
Similarity:168/430 - (39%) Gaps:84/430 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEWTREKTLQLISEYRSRRGLWDMTCDEYRKKDVKQRLLNEVSQVLGGNIPINELEKKFHTLRTQ 65
            ||...||  :||:..:....:::...:.||...:|..:..|:::.|..:  :.:...|:..||.|
  Fly   311 MESYFEK--ELITLIQQEDMIYNYGNENYRNAKLKMEVWEEIARKLKKS--VKQCRLKWKALRDQ 371

  Fly    66 YHREISRMKRKEPYN--SKWFGFKNLVFLSSPYACRSTKGRLKADLQ-------GDERKFVLGEV 121
            |.||..|::.....:  |:|..:.:|.||.. |..:.|   |::|.|       .|..:.:...:
  Fly   372 YAREHKRLRTLMHIDATSRWKHYNSLSFLQK-YIQQKT---LESDSQLSMLLPKNDPVRELEDHM 432

  Fly   122 TADHNSDSSTPANHNSNTNANMN---EEYLRKNHASSRAQELEKLIEETTKDVDDIDESELEEGE 183
            |..|:..:......:|::|:.:|   ..:|...|.:.:.|:.::..|:.       .:.:..:.:
  Fly   433 TQSHSPPTQQITLESSSSNSQLNLPTLPHLTGPHKAEQQQQQQQQEEQH-------QQQQQHQQQ 490

  Fly   184 VKPKQAKEMSVRFVSLNEQEETEPLENHHQTLMDLHHQGNAVEAVSFQANESGELHYQTTPTQST 248
            .:.:||.|:.|  .:.::.:    :||:...  |:||..:.||     .:|..|:...|...|..
  Fly   491 QQQQQASELCV--ATYDDMD----IENYING--DVHHNDDDVE-----DDEDEEMETTTAAEQPP 542

  Fly   249 GSSSVHVMPTRIIKIQRRDTSSGQEDSYFEEHTQLH--PPPVKRMYYEASPASHNTTSILSPALE 311
            .....|||                  :|..|...::  .|.|.....:....|...||:.:..|:
  Fly   543 QQQDQHVM------------------TYDHEDGPVYMAVPSVGSAMSKQEQLSDGATSLENQQLQ 589

  Fly   312 SSANGTASSVLT-TSPGITMSNLRLPKVNTPPKPAQAQAIPS----PPPPTIVSLPPAR------ 365
            |:|......:.| |:|       |.....|.|.........|    |..||.:..|.:.      
  Fly   590 STAEFQKIEIQTPTTP-------RYQNAATTPSSTSTSRYHSAPITPSKPTHMEYPSSNGHNSGE 647

  Fly   366 -DEFATYGEYVANEMR-----AISNREVLVALKHRINTAI 399
             ||...:.:.|:.::|     .::..|:.:.:...||.|:
  Fly   648 DDEIGAFFKAVSMKIRNAQLEPVAFTELQIDILRVINEAL 687

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11504NP_651758.1 MADF_DNA_bdg 11..92 CDD:287510 18/82 (22%)
CytochromB561_N 238..>409 CDD:286826 34/181 (19%)
CG8765NP_649141.1 MADF 42..123 CDD:214738
MADF 318..405 CDD:214738 21/89 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.