DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11504 and CG3919

DIOPT Version :9

Sequence 1:NP_651758.1 Gene:CG11504 / 43557 FlyBaseID:FBgn0039733 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001261840.1 Gene:CG3919 / 39582 FlyBaseID:FBgn0036423 Length:318 Species:Drosophila melanogaster


Alignment Length:353 Identity:71/353 - (20%)
Similarity:119/353 - (33%) Gaps:108/353 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LWDMTCDEYRKKDVKQRLLNEVSQVLGGNIPINELEKKFHTLRTQYHREISRMKRKEPY--NSKW 83
            |:|...|.|.:|...:....|:|..:..:  :...::::..:|:.|.|.|........|  ||: 
  Fly    31 LYDRHDDNYLRKSTVKNAWKEISNEMRNS--VKSCKERWRNIRSSYARSIKLHHGANTYYLNSE- 92

  Fly    84 FGFKNLVFLSS------PYACRSTKGRLKADLQGDERKFVLGEVTADHNSDSSTPAN------HN 136
                 |.||..      |...|..:.|.|...:.||             .|..||..      |:
  Fly    93 -----LKFLQKHITPGVPVPLRGRRSRPKGQEEHDE-------------GDPETPVEAILEMVHS 139

  Fly   137 SNTNANMNEEYLRKNHASSRAQELEKLIEETTKDVDDIDESELEEGEVKPKQAKEMSVRFVSLNE 201
            .:        :|...||.||            ...|....:::|        |.:.:....|:.:
  Fly   140 PS--------FLNSEHAQSR------------HSTDPASATDVE--------ATQFNNEPSSIMD 176

  Fly   202 QEETEPLENHHQTLMDLHHQGNAVEAVSFQANESGELHYQTTPT---QSTGSSSVHVMPTRIIKI 263
            .|:|.|.|      |......:..||      :.||:.....|.   ..|.:..:..:|     |
  Fly   177 FEDTVPAE------MRTESDSSEKEA------KVGEITLYRVPLLEFPKTSTRCIEALP-----I 224

  Fly   264 QRRDTSSGQ----EDSYFEEHTQLHPPPVKRMYYEA------SPASHNTTSILSPALESSANGTA 318
            ...|.:..|    |..:...|.:|:   .||..|:.      |..|.::|....|....:.||| 
  Fly   225 MDFDDAFLQGLRPEIKHMNFHQKLY---FKRRVYDLLGEIFHSEQSASSTHPAQPHPRENVNGT- 285

  Fly   319 SSVLTTSPGITMSN--------LRLPKV 338
               |:|:..::.:|        |:|||:
  Fly   286 ---LSTTSSLSSANPLQHMGLMLQLPKL 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11504NP_651758.1 MADF_DNA_bdg 11..92 CDD:287510 15/72 (21%)
CytochromB561_N 238..>409 CDD:286826 26/122 (21%)
CG3919NP_001261840.1 MADF 20..100 CDD:214738 17/76 (22%)
BESS 226..260 CDD:281011 8/36 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.