DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11504 and CG6175

DIOPT Version :9

Sequence 1:NP_651758.1 Gene:CG11504 / 43557 FlyBaseID:FBgn0039733 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001261708.1 Gene:CG6175 / 39271 FlyBaseID:FBgn0036152 Length:569 Species:Drosophila melanogaster


Alignment Length:539 Identity:112/539 - (20%)
Similarity:176/539 - (32%) Gaps:174/539 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEWTREKTLQLISEYRSRRGLWDMTCDEYRKKDVKQRLLNEVSQVLGGNIPINELEKKFHTLRTQ 65
            :||:|...|..|.:||.:|.|||.....|..|..|...|..:||..|  ..|..:..|..:||:.
  Fly    54 VEWSRSTILNFIEDYRRQRVLWDPNTKGYHIKQTKYEALKLLSQKYG--TEIRSIRSKIKSLRSS 116

  Fly    66 YHRE----ISRMKRKEPYNSKWFGFKNLVFLSSPYACRSTKGRLKADLQGDERKFVLGEVTAD-- 124
            :|||    :|...|...|...||.::.:.|:        ..|....|...|:.:....|...|  
  Fly   117 FHREHGKVLSGRNRGVIYQPMWFAYEAIRFI--------LDGERDQDRDQDQDQDAETETEVDEK 173

  Fly   125 ----HNSD-SSTPANHNSNTNANMNEEYLRKNH------------------ASSRAQELEKLIEE 166
                |:.| ....|:...:.:..:..|..::.|                  |::.|::.|:.: :
  Fly   174 LALMHSLDLEQLKADKLVDRDIILQVEQQQQQHDELTARIAATVAAVAAAAAAANARDRERDV-D 237

  Fly   167 TTKDVDDIDESELEE----------------------------------GE----VKPKQAKEMS 193
            |..|:|...|.||||                                  ||    :..:..|...
  Fly   238 TAGDMDTTRELELEEAAVGGGLIESSSAAVRLDWRVCIDFCTRSSSDLDGENYCNISAEDVKTEI 302

  Fly   194 VRFVS--------------LNEQEETEPLENHHQ-------------TLMDLHHQGNAVEA--VS 229
            :...|              :|..:.|:...||.:             ||..:...|.||.|  |.
  Fly   303 IEHESELGMLDRRTSTPSPINYYKPTDLTYNHRKRKAMGVEHVVGALTLTPIKVVGGAVGAGTVG 367

  Fly   230 FQANESGELHYQTTPTQST--------------GSSSVHVMPTRIIKIQRRDTSSGQEDSYFEEH 280
            ...::..:.|.|.....|.              |.|..|              .:||.....::|
  Fly   368 SAGHQQQQQHQQQQMNHSQLAFQALQQHFSHNHGLSLSH--------------CNGQPQQQQQQH 418

  Fly   281 TQLHPPPVKRMYYEASPASHNTTSILSPAL-----------ESSANGTASSVLTTS--PGITMSN 332
             |..|...::...:|....|......|..:           .|:.||.:|:...||  |..|.||
  Fly   419 -QHQPHHQQQQQQQALHLQHQQQQQHSSNMAQKRDRDRDLSTSNGNGNSSNTNNTSLEPIATSSN 482

  Fly   333 LRLPKVN----TPPKP------AQAQAIPSPPPPTIVSLPPARDEFATYGEYVANEMRAISNREV 387
            ......|    |||||      ..|..:               ||:..:|||||..:|.:...:.
  Fly   483 CSSSSSNNSAATPPKPLLGGGGLSANHV---------------DEYGVFGEYVAITIRKLKTSKS 532

  Fly   388 LVALKHRINTAIFEASMAE 406
            .:.:||.||..::||.:.:
  Fly   533 KIVVKHLINNLLYEAELGK 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11504NP_651758.1 MADF_DNA_bdg 11..92 CDD:287510 26/84 (31%)
CytochromB561_N 238..>409 CDD:286826 45/206 (22%)
CG6175NP_001261708.1 MADF_DNA_bdg 64..147 CDD:287510 26/84 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2D0D8
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.