DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11504 and CG6683

DIOPT Version :10

Sequence 1:NP_651758.1 Gene:CG11504 / 43557 FlyBaseID:FBgn0039733 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_648232.1 Gene:CG6683 / 38970 FlyBaseID:FBgn0035902 Length:197 Species:Drosophila melanogaster


Alignment Length:178 Identity:40/178 - (22%)
Similarity:64/178 - (35%) Gaps:48/178 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 TRIIKIQRRDTSSGQED---SYFEEHTQLHP----PPVKRMYYEASPA----SHNTTSILSPALE 311
            ||:|::.|.:....:.:   :.:|.|.:.||    .....:..|||..    :|..........:
  Fly     6 TRLIELVRANPKLYERELRNAPYEAHKKRHPEIWSSIATSLNSEASACVSRWNHLVAKQRRELAK 70

  Fly   312 SSANGTAS--SVL---------------TTSPGITMSNLR-LPKVNTPPKPAQ---------AQA 349
            ..|.||.|  |:|               ..|..::.|.|: ..:||....|.|         |.|
  Fly    71 EKAGGTGSDWSLLPHLKFLQHHHHPINHRNSGDLSRSTLKSSDEVNDDEDPLQEAMDEQLAVAGA 135

  Fly   350 IPSPPPPTIVSLPPARDE------FATYGEYVANEMRAISNREVLVAL 391
            .|:||.....:.|.|:.|      ....||  ||.::|  .:.:|..|
  Fly   136 APAPPTNPAHATPVAQAEKRIEALLEGLGE--ANRIKA--EKRILAYL 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11504NP_651758.1 MADF_DNA_bdg 11..92 CDD:463144
CG6683NP_648232.1 MADF 7..94 CDD:214738 17/86 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.