DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11504 and CG7745

DIOPT Version :9

Sequence 1:NP_651758.1 Gene:CG11504 / 43557 FlyBaseID:FBgn0039733 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_610671.1 Gene:CG7745 / 36210 FlyBaseID:FBgn0033616 Length:506 Species:Drosophila melanogaster


Alignment Length:340 Identity:65/340 - (19%)
Similarity:121/340 - (35%) Gaps:90/340 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 EYRSRRGLWDM----------TCDEYRKKDVKQRLLNEVSQVLGGNIPINE------LEK-KFHT 61
            :|.::...|.:          ||.: |.|.:::|.   |||...|:.|:.|      ||| ||  
  Fly    32 KYETKDEAWQLIAMKLRTDVDTCKK-RWKYLRERY---VSQRKQGDPPVYEHLSRPYLEKMKF-- 90

  Fly    62 LRTQYHREISRMKRKEPYNSKWFGFKNLVFLSSPYACRSTKGRLKADLQGDERKFVLGEVTADHN 126
              ...|.:..:..|..|.           ||:||.:..|:...                   ::.
  Fly    91 --LDQHIQPRKSYRHVPN-----------FLTSPQSANSSGYN-------------------EYQ 123

  Fly   127 SDSSTPANHNSNTNANMNEEYL----RKNHASSRAQELEKLIEETTKDVDDIDESELE--EGEVK 185
            .|.|..:..|.:...:..:.:|    .:.||.|.              :.::..|.||  .|:||
  Fly   124 VDKSNGSMKNVSQFGSSGQSHLYHQPDQQHAMSA--------------LSNVAASALENVNGQVK 174

  Fly   186 PKQAKEMSVRFVSLNEQEETEPLENHHQTLMDLHHQGNAVEAVSFQANESGELHYQTTPTQSTGS 250
             .:|.::...|.:....::.:     |.:...:..|..||.||...:::..:..|:.......|:
  Fly   175 -IEADQVFRDFAAAVASQQLQ-----HISQSQMQQQAAAVAAVMADSSQGYQDQYKDGSVGMNGA 233

  Fly   251 SSVHVMPTRIIKIQRRDTSS-----GQEDSYFEEHTQLHPPPVKRMYYEASPASHNTTSILSPAL 310
            .:.....|......:...||     |....:.::.||......::...:.||||....    |.:
  Fly   234 QNSAGSLTSTSSSMKSPLSSPLQGIGAGSHHPQQQTQQQQQQQQQQAQQQSPASEQQL----PVV 294

  Fly   311 ESSANGTASSVLTTS 325
            .||::.|.:|:..:|
  Fly   295 HSSSSATGASIGNSS 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11504NP_651758.1 MADF_DNA_bdg 11..92 CDD:287510 21/94 (22%)
CytochromB561_N 238..>409 CDD:286826 18/93 (19%)
CG7745NP_610671.1 MADF 5..96 CDD:214738 19/71 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.