DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11504 and CG10949

DIOPT Version :9

Sequence 1:NP_651758.1 Gene:CG11504 / 43557 FlyBaseID:FBgn0039733 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001286101.1 Gene:CG10949 / 35310 FlyBaseID:FBgn0032858 Length:459 Species:Drosophila melanogaster


Alignment Length:428 Identity:84/428 - (19%)
Similarity:144/428 - (33%) Gaps:106/428 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LWDMTCDEYRKKDV-KQRLLNEVSQVLGGNIPINELEK----KFHTLRTQYHREISRMKRKEPYN 80
            |:|..|....|... |......:||.||.:      |:    ::.::|.::.:|..|.:.:....
  Fly    16 LYDKDCARSVKNAAQKDAAWKAISQKLGAS------ERACITRWKSIRDRFGKEFRRFQERPDEP 74

  Fly    81 SKWFGFKNLVFLSSPYACRSTKGRLKADLQGDERKFVLGEVTADHNSDSSTPANHNSNTNANMNE 145
            :.|..|..|:||...|     |..|..:...|..:|              .|......|..:|.:
  Fly    75 TYWDMFPRLLFLKDHY-----KQGLARNESLDGMRF--------------EPRERKKRTKVDMEQ 120

  Fly   146 EYLRKNHASSRAQE---LEKLIEETTKDVDDIDESELEEGEVKPKQAKEMSVRFVSLNEQEETEP 207
            |..||:.....:|:   .|:|||.........|..::...  |...||..:.|.:|.|.....|.
  Fly   121 ERRRKDEEEEDSQDDLLNEQLIELVKSHPVLYDRHKIRVS--KNLAAKNEAWREISENLNVSEEL 183

  Fly   208 LENHHQTLMDLHHQGNAVEAVSFQANESGEL-------------HYQ--------------TTPT 245
            ..|..:.|.|...:    |..|.|.|:|..:             |::              ..|.
  Fly   184 CYNRWKKLRDRFGR----EFRSHQINQSTPITWRYFNDLLFLGRHFRKGVPLVLENIKRRGRPPK 244

  Fly   246 QSTGSSSVHVMPTRIIKIQRRDTSSGQEDSYFEEHTQLHPPPVKRMYYEASPASHNTTSILSPAL 310
            ....|......|..:: |...:...|.:..|..::..|..        :...|......|||.|.
  Fly   245 AGNPSGKTSKQPEGMV-ISSGEQIWGADYPYSTDNDDLED--------DLELAYDEEIEILSEAE 300

  Fly   311 ESS------ANGTAS---------SVLTTSPGITMSNLR-LPKVNTPPKPAQAQAIPSPPPPTIV 359
            :::      :..||.         .|.||:|..:...:. :.:||  |...::.::|..      
  Fly   301 QATPYDFILSEATARQDLEPPQQLQVTTTTPATSEEIIHTIARVN--PVVEESSSLPGD------ 357

  Fly   360 SLPPA--RDEFATYGEYVANEMRAI--SNREVLVALKH 393
            |:|.|  .|:..|  ..:|| |..:  .:||:...:.|
  Fly   358 SVPSAAISDKLLT--TVIAN-METVLQQSRELQAQIHH 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11504NP_651758.1 MADF_DNA_bdg 11..92 CDD:287510 16/75 (21%)
CytochromB561_N 238..>409 CDD:286826 34/203 (17%)
CG10949NP_001286101.1 MADF 5..91 CDD:214738 19/85 (22%)
MADF 140..226 CDD:214738 20/91 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.