DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11504 and CG15601

DIOPT Version :9

Sequence 1:NP_651758.1 Gene:CG11504 / 43557 FlyBaseID:FBgn0039733 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_573058.1 Gene:CG15601 / 32509 FlyBaseID:FBgn0030673 Length:277 Species:Drosophila melanogaster


Alignment Length:344 Identity:65/344 - (18%)
Similarity:121/344 - (35%) Gaps:108/344 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TREKTLQLISEYRSRRGLWDMTCDEYRKKDVKQRLLNEVSQVLGGNIP---INELEKKFHTLRTQ 65
            |:....:.:..||.:..|::...|.|:.:..::.....:.:.|  .||   :::::.|..::||.
  Fly     7 TKIPITEFLEAYRRQPCLYNTLLDSYKNRVSREEAYGAIIRSL--KIPQLTVSDIKLKIKSVRTV 69

  Fly    66 YHREIS-RMKRKE---PYNSKWFGFKNLVFLSSPYACRSTKGRLKADLQGDERKFVLGEVTADHN 126
            |.:|:. .|:.||   .|..|.|.|:    |:..:                     |..|:..|.
  Fly    70 YSKELRIWMREKELGRTYEPKLFWFR----LADSF---------------------LRSVSLSHC 109

  Fly   127 SDSSTPANHNSNTNANMNEEYLRKNHASS------RAQELEKLIEETTKDVDDIDESELEEGEVK 185
            ....                   ||::||      ::.|..||:.....|: .:.|..|||.:.:
  Fly   110 KRQG-------------------KNNSSSAQLTTIKSDETSKLLCTAAADI-TMSEDALEEEDAE 154

  Fly   186 PKQAKEMSVRFVSLNEQEETEPLENHHQTLMDLHHQGNAVEAVSFQANESGELHYQTTPTQSTGS 250
                         :|.:.|..|||....|......     ::....|::..:.||      |.|.
  Fly   155 -------------VNGEPEECPLEESRPTASICKD-----DSTLCLADQPQQEHY------SQGC 195

  Fly   251 SS----VHVMPTRIIKIQRRDTSSGQE-----------------DSYFEEHTQLHPPPVKRMYYE 294
            ||    .|.|..|..|......|:|::                 |||.....:|.   ::::.:|
  Fly   196 SSSQQLPHTMAQRKSKYITSLDSAGEDDLIIFGQSIASQLRTIPDSYSRSVAKLR---IQQVLFE 257

  Fly   295 ASPASHNTTSILSPALESS 313
            |......:|.:.|..|:::
  Fly   258 AETGQFQSTEVNSTQLQNT 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11504NP_651758.1 MADF_DNA_bdg 11..92 CDD:287510 20/87 (23%)
CytochromB561_N 238..>409 CDD:286826 21/97 (22%)
CG15601NP_573058.1 MADF_DNA_bdg 14..101 CDD:287510 21/113 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2D0D8
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.