DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11504 and CG8119

DIOPT Version :9

Sequence 1:NP_651758.1 Gene:CG11504 / 43557 FlyBaseID:FBgn0039733 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_573050.1 Gene:CG8119 / 32500 FlyBaseID:FBgn0030664 Length:244 Species:Drosophila melanogaster


Alignment Length:284 Identity:59/284 - (20%)
Similarity:106/284 - (37%) Gaps:64/284 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 NSDSSTPANHNSNTNANMNEEYLRKNHASSRAQELEKLIEETTKDVDDIDESELEEGEVKPKQAK 190
            ::|:..|.| |..||..:.|..||.:...||   ::..:......:|.:|.|..           
  Fly     3 SADNKYPTN-NLETNHLLREIALRPSIWDSR---IKFSLRRPQIPIDWLDVSNA----------- 52

  Fly   191 EMSVRFVSLNEQE---ETEPLENHHQTLMDLHHQGNAVEAVSFQANESGEL-------HYQTTPT 245
                  |.|...|   ..:.|.|:::|.:   ||||   |.|:..::..|.       |...||.
  Fly    53 ------VGLGVDECKRRWKSLRNNYRTKI---HQGN---AWSWPHSKQMEFVRDVFPPHKPKTPA 105

  Fly   246 QSTGSSSVHVMPTRIIKIQRRDTSSGQEDSYFEEHTQLHPPPVKRMYYEASPASHNTTSILSPAL 310
            :    ..|.|..:::|...::...|....|.|::         ..:.:||.......|.  .||.
  Fly   106 R----CRVQVKKSKLILHPQQYLQSVASYSAFKK---------GGIEFEAEERLFLVTD--EPAF 155

  Fly   311 ESSANGTASSVLTTSPGITMSNL---RLPKVNTPPKPAQAQAIPSPPPPTIVSLPP--------A 364
            :...:...:.:|.|...:..:||   .||....||..|.|:.........::|:.|        :
  Fly   156 DLDVDEEVTRLLGTDQWLWQTNLDFILLPIFRAPPPSAMAKISNESNRHFLLSMVPMLRSLSDRS 220

  Fly   365 RDEFATYGEYVANEMRAISNREVL 388
            ::.|.::...|..|| .|:.:::|
  Fly   221 KERFRSWTRRVLREM-LIAEKKLL 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11504NP_651758.1 MADF_DNA_bdg 11..92 CDD:287510
CytochromB561_N 238..>409 CDD:286826 32/169 (19%)
CG8119NP_573050.1 MADF 17..97 CDD:214738 21/105 (20%)
BESS 201..234 CDD:281011 4/32 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.