DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11504 and madf-9

DIOPT Version :9

Sequence 1:NP_651758.1 Gene:CG11504 / 43557 FlyBaseID:FBgn0039733 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_500389.2 Gene:madf-9 / 191167 WormBaseID:WBGene00022608 Length:333 Species:Caenorhabditis elegans


Alignment Length:414 Identity:80/414 - (19%)
Similarity:139/414 - (33%) Gaps:142/414 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEWTREKTLQLISEYRSRRGLWDMTCDEYRKKDVKQRLLNEVSQVLGGNIPINELEKKFHTLRTQ 65
            :|.|....::||:|.::|..|:|.:.:.|.....:....||:::.|  ......::.::.|||.:
 Worm    43 IEETPVFNIRLIAEVKARPFLYDQSDEGYNLLSWRNSAWNEIAENL--ETTSEHVKTRWKTLRDR 105

  Fly    66 YHREISRMKRKEPYNSKWFGFKNLVFLSSPYACRSTKGRLKADLQGDERKFVLGEVTADHNSDSS 130
            |.:| .:.:|.....|.|...:.|.|:.:                              |..|  
 Worm   106 YKKE-EKKERVSKKASSWVFQRPLKFIQA------------------------------HLKD-- 137

  Fly   131 TPANHNSNTNANMNEEYLRKNHASSRAQELEKLIEETTKDVDDIDESELEEGEVKPKQAKEMSVR 195
               .|...|::|.:|..::..                            ..|.|.|.:|   ::.
 Worm   138 ---RHTDETDSNQSEPAVKPE----------------------------PNGHVSPMEA---AMS 168

  Fly   196 FVSLNEQEETEPLENHHQTLMDLHHQGNAVEAVSFQANESGELHYQTTPTQSTGSSSVHVMPTRI 260
            |:. ||...|:.                    .|..:..:||:...:..|.|:.|||        
 Worm   169 FIE-NELIRTQD--------------------SSKSSGSTGEMESSSASTASSASSS-------- 204

  Fly   261 IKIQRRDTSSGQEDSYFEEHTQLHPPPVK-RMYYEASPASHNTTSILSPALESSANGTASSVLTT 324
               :...|..|.|.|.      :.|||:. .|....||:          |..|::||        
 Worm   205 ---KNTGTQEGGEASV------ITPPPLPIPMAVTPSPS----------ATSSASNG-------- 242

  Fly   325 SPGITMSNLRLPKVNTPPKPAQAQAIPSPPPPTIVSLPPARDEFATYGEYVANEM--RAIS---- 383
            .|.:..|.:.:.:..||  .|...|..:......:|..|...::||..|...:|:  |.||    
 Worm   243 GPAVKRSRVSITEGMTP--VASRNAAAAAAASLGLSFFPGLSQWATTREEEEDEIFARMISIKLS 305

  Fly   384 -----NREVLVALKHRINTAIFEA 402
                 .:||   .|.::..|||:|
 Worm   306 KLDARTKEV---AKLQVLKAIFDA 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11504NP_651758.1 MADF_DNA_bdg 11..92 CDD:287510 19/80 (24%)
CytochromB561_N 238..>409 CDD:286826 41/177 (23%)
madf-9NP_500389.2 MADF 52..136 CDD:214738 21/116 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003392
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.