DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11504 and madf-3

DIOPT Version :10

Sequence 1:NP_651758.1 Gene:CG11504 / 43557 FlyBaseID:FBgn0039733 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_494766.1 Gene:madf-3 / 186755 WormBaseID:WBGene00019218 Length:312 Species:Caenorhabditis elegans


Alignment Length:87 Identity:31/87 - (35%)
Similarity:44/87 - (50%) Gaps:7/87 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LQLISEYRSRRGLWDMTCDEYRKKDVKQRLLNEVSQVLGGNIPINELEKKFHTLRTQYHREISRM 73
            |:||...|..|.|:|.|..:||..:.|.|:...:..|||.:.....|..::..||.:|.:|    
 Worm     8 LRLIEAVRHSRCLFDNTDRQYRNTEYKNRVWQRLVTVLGFDGDPRMLSARWKQLRDKYGKE---- 68

  Fly    74 KRKEPY---NSKWFGFKNLVFL 92
            |||:.|   .|.|..||:|.||
 Worm    69 KRKQKYGNEKSSWQYFKHLHFL 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11504NP_651758.1 MADF_DNA_bdg 11..92 CDD:463144 28/83 (34%)
madf-3NP_494766.1 MADF 9..94 CDD:214738 30/86 (35%)
MADF 122..212 CDD:214738
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.