DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11504 and si:zfos-128g4.1

DIOPT Version :9

Sequence 1:NP_651758.1 Gene:CG11504 / 43557 FlyBaseID:FBgn0039733 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_002661969.1 Gene:si:zfos-128g4.1 / 100334256 ZFINID:ZDB-GENE-141212-382 Length:248 Species:Danio rerio


Alignment Length:293 Identity:52/293 - (17%)
Similarity:106/293 - (36%) Gaps:82/293 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EKTLQLISEYRSRRGLWDMTCDEYRKKDVKQRLLNEVSQVLGGNIPINELEKKFHTLRTQYHREI 70
            ||.:|.:..:..   |::::..:||..:.:.:...||:..:|  :.:.|.::::.|:|.:|.||.
Zfish     7 EKLIQTVYAFPV---LYNVSLHDYRSTERRVKAWREVAASVG--LSVVECKRRWKTIRDRYIRER 66

  Fly    71 SRMKRKEPYNSK----WFGFKNLVFLSSPYACRSTKGRLKADLQGDERKFVLGEVTADHNSDSST 131
            ...|.|:....:    |...::|.||.:    ...|.|..:..||.                   
Zfish    67 RLCKLKKDLGGRRLHYWPHRESLAFLDA----HIRKRRRPSGAQGP------------------- 108

  Fly   132 PANHNSNTNANMNEEYLRKNHASSRAQELEKLIEETTKDVDDIDESELEEGE---VKPKQAKEMS 193
                         ||..::.|:|:..||          |.:.:.|..::.|.   |.|     :.
Zfish   109 -------------EEEQQEEHSSAALQE----------DKECVSEECVDSGSRLAVSP-----LP 145

  Fly   194 VRFVSLNEQEETEPLENHHQTLMDLHHQGNAVEAVSFQANESGELHYQTTPTQSTGSSSVHVMPT 258
            |..:|.....:.:.:......|:.....|..|..|.               :.:|||:|...:..
Zfish   146 VSIMSAPPPPQLKAVPQVSPLLLAALPPGLKVAPVC---------------SSATGSASAGPLNV 195

  Fly   259 RIIKIQRRDTSSGQEDSYFEEHTQLHPPPVKRM 291
            .:.:.||.|.:..::..:...:.    |.:||:
Zfish   196 PLEEQQRADGALDEDQLFLLSYV----PALKRL 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11504NP_651758.1 MADF_DNA_bdg 11..92 CDD:287510 16/84 (19%)
CytochromB561_N 238..>409 CDD:286826 10/54 (19%)
si:zfos-128g4.1XP_002661969.1 MADF 8..97 CDD:214738 20/97 (21%)
BESS 208..242 CDD:281011 3/21 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003392
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.