DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11504 and LOC100330838

DIOPT Version :9

Sequence 1:NP_651758.1 Gene:CG11504 / 43557 FlyBaseID:FBgn0039733 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001373242.1 Gene:LOC100330838 / 100330838 -ID:- Length:204 Species:Danio rerio


Alignment Length:182 Identity:36/182 - (19%)
Similarity:69/182 - (37%) Gaps:34/182 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EKTLQLISEYRSRRGLWDMTCDEYRKKDVKQRLLNEVSQVLGGNIPINELEKKFHTLRTQYHREI 70
            |:.:..:|:|..   |::.|.:.|:....|.:....||  |...||..:..:::.:||..:.::.
Zfish     7 ERLIAAVSDYPE---LYNSTINSYKDAARKAKAWRAVS--LQVEIPEEDCRRRWKSLRDMFIKDK 66

  Fly    71 SRMKRKEPYNSKWFGFK---NLVFLSSPYACRSTKGRLKADLQGDERK-----------FVLGEV 121
            ...:|:....:....:|   .:.||:.....||.......:.:.||.|           ||:.:.
Zfish    67 RAEQRRRASGTSHRSWKYSWQMSFLTPFIQSRSLAADEPEEDRDDEDKDEERTADGNSAFVVQDF 131

  Fly   122 TADHNSDSSTPANHNSNTNANMNEEYLRKNHASSRAQELEKLIEETTKDVDD 173
            ..||.....  |:|.| .:.:......||.|.            |..:|::|
Zfish   132 EGDHGMLDG--ASHYS-ASGSQGSGRKRKWHM------------EANEDLED 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11504NP_651758.1 MADF_DNA_bdg 11..92 CDD:287510 15/83 (18%)
CytochromB561_N 238..>409 CDD:286826
LOC100330838NP_001373242.1 MADF 8..96 CDD:214738 17/92 (18%)
BESS 167..200 CDD:397204 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003392
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.