DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15525 and AT3G05070

DIOPT Version :10

Sequence 1:NP_651757.1 Gene:CG15525 / 43556 FlyBaseID:FBgn0039732 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_566245.1 Gene:AT3G05070 / 819669 AraportID:AT3G05070 Length:144 Species:Arabidopsis thaliana


Alignment Length:141 Identity:51/141 - (36%)
Similarity:77/141 - (54%) Gaps:24/141 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LTQESLKRKERLQKLR-----EQVQNKGGDAAESIEKLPKPVFRSYKPQ-NETTDGEILA----- 65
            :.|::..|||.|:.||     .:.:..|.|.|.. |..|...||:|.|| .|..||::..     
plant     8 IEQKAAARKEALKALRAAQELSETKEDGEDEAVE-EDGPAMKFRNYVPQAKELQDGKLAPPELPK 71

  Fly    66 -QEPTGNIESAVEDQLSLLQQPMVIDEIDITNLAPRKPDWDLKRDASKKLERLERRTQKAIAELI 129
             ::|...:..|||.:    :.|.|       |:||:||:|||:||..|||::||||||||:.:|:
plant    72 FEDPIVALPPAVEKK----EDPFV-------NIAPKKPNWDLRRDVQKKLDKLERRTQKAMHKLM 125

  Fly   130 RERLKLNQMED 140
            .|:.|..:|.:
plant   126 EEQEKEREMAE 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15525NP_651757.1 cwf18 11..133 CDD:462423 49/132 (37%)
AT3G05070NP_566245.1 cwf18 7..128 CDD:462423 48/131 (37%)

Return to query results.
Submit another query.