DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15525 and Ccdc12

DIOPT Version :9

Sequence 1:NP_651757.1 Gene:CG15525 / 43556 FlyBaseID:FBgn0039732 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_082588.2 Gene:Ccdc12 / 72654 MGIID:1919904 Length:166 Species:Mus musculus


Alignment Length:163 Identity:70/163 - (42%)
Similarity:98/163 - (60%) Gaps:14/163 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GVGKLTQESLKRKERLQKLREQVQNKG-----------GDAAESIEKLPKPVFRSYKPQNETTDG 61
            |||:|.:|:|:|||||:.|||:...|.           .:..|.:.|......|:|.|::|....
Mouse     7 GVGRLEEEALRRKERLKALREKTGRKDREDGEPQTKQLREEGEEVGKHRGLRLRNYVPEDEDLKR 71

  Fly    62 EILAQEPTGNIESAVEDQLSLLQQPMVIDEIDITNLAPRKPDWDLKRDASKKLERLERRTQKAIA 126
            ..:.|.....:|..|::||...:...||:|:|:.||||||||||||||.:||||:||:|||:|||
Mouse    72 RRVPQAKPVAVEEKVKEQLEAAKPEPVIEEVDLANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIA 136

  Fly   127 ELIRERLKLNQMEDISQAVNVATAHAGESVQED 159
            |||||||| .|.:.::.||:..|..  |:...|
Mouse   137 ELIRERLK-GQEDSLASAVDATTGQ--EACDSD 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15525NP_651757.1 cwf18 11..132 CDD:285510 57/131 (44%)
Ccdc12NP_082588.2 cwf18 11..143 CDD:369809 58/131 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..55 8/33 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..166 5/21 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831434
Domainoid 1 1.000 108 1.000 Domainoid score I6480
eggNOG 1 0.900 - - E1_KOG3407
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41751
Inparanoid 1 1.050 120 1.000 Inparanoid score I4768
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52393
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005517
OrthoInspector 1 1.000 - - oto95329
orthoMCL 1 0.900 - - OOG6_103244
Panther 1 1.100 - - LDO PTHR31551
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R274
SonicParanoid 1 1.000 - - X3935
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.