DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15525 and Ccdc12

DIOPT Version :9

Sequence 1:NP_651757.1 Gene:CG15525 / 43556 FlyBaseID:FBgn0039732 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_001102253.1 Gene:Ccdc12 / 363151 RGDID:1306081 Length:166 Species:Rattus norvegicus


Alignment Length:163 Identity:70/163 - (42%)
Similarity:101/163 - (61%) Gaps:14/163 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GVGKLTQESLKRKERLQKLREQVQNK----GGDAAESIEKLPKPV-------FRSYKPQNETTDG 61
            |||:|.:|:|:|||||:.|||:...|    |....:.:.:..:.|       .|:|.|::|....
  Rat     7 GVGRLEEEALRRKERLKALREKTGRKDREDGEPQTKQLREEEEEVGKHRGLRLRNYVPEDEDLKR 71

  Fly    62 EILAQEPTGNIESAVEDQLSLLQQPMVIDEIDITNLAPRKPDWDLKRDASKKLERLERRTQKAIA 126
            ..:.|.....:|..|::||...:...||:|:|:.||||||||||||||.:||||:||:|||:|||
  Rat    72 RRVPQAKPVAVEEKVKEQLEAAKPEPVIEEVDLANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIA 136

  Fly   127 ELIRERLKLNQMEDISQAVNVATAHAGESVQED 159
            |||||||| .|.::::.||:..|..  |:...|
  Rat   137 ELIRERLK-GQEDNLASAVDATTGQ--EACDSD 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15525NP_651757.1 cwf18 11..132 CDD:285510 57/131 (44%)
Ccdc12NP_001102253.1 cwf18 11..143 CDD:311976 58/131 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335171
Domainoid 1 1.000 108 1.000 Domainoid score I6359
eggNOG 1 0.900 - - E1_KOG3407
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41751
Inparanoid 1 1.050 121 1.000 Inparanoid score I4674
OMA 1 1.010 - - QHG52393
OrthoDB 1 1.010 - - D1604272at2759
OrthoFinder 1 1.000 - - FOG0005517
OrthoInspector 1 1.000 - - oto98814
orthoMCL 1 0.900 - - OOG6_103244
Panther 1 1.100 - - LDO PTHR31551
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3935
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.