DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15525 and CCDC12

DIOPT Version :9

Sequence 1:NP_651757.1 Gene:CG15525 / 43556 FlyBaseID:FBgn0039732 Length:161 Species:Drosophila melanogaster
Sequence 2:XP_011531692.1 Gene:CCDC12 / 151903 HGNCID:28332 Length:215 Species:Homo sapiens


Alignment Length:132 Identity:30/132 - (22%)
Similarity:46/132 - (34%) Gaps:45/132 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ESLKRKERLQKLREQVQNKGGDAAESIEKLPKPV----------------------FRSYKPQNE 57
            |.||::...|.....|:.|..:..|:.:  |:||                      |.:..|...
Human    87 EDLKKRRVPQAKPVAVEEKVKEQLEAAK--PEPVIEEVVSAWTTLASSLLLCVLFLFATCSPSAP 149

  Fly    58 TTDGEILAQEPTGNIESAVE------DQLSLLQQP--------------MVIDEIDITNLAPRKP 102
            .:...:|...||... :.|.      ..:|||.:|              .::...|:.|||||||
Human   150 HSFSSLLYSLPTSPF-ALVPLLPPPLSPISLLLEPALPLVLGWPLHPDVCLLPSQDLANLAPRKP 213

  Fly   103 DW 104
            ||
Human   214 DW 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15525NP_651757.1 cwf18 11..132 CDD:285510 30/132 (23%)
CCDC12XP_011531692.1 cwf18 <73..>122 CDD:285510 10/36 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141480
Domainoid 1 1.000 107 1.000 Domainoid score I6558
eggNOG 1 0.900 - - E1_KOG3407
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41751
Inparanoid 1 1.050 121 1.000 Inparanoid score I4768
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52393
OrthoDB 1 1.010 - - D1604272at2759
OrthoFinder 1 1.000 - - FOG0005517
OrthoInspector 1 1.000 - - oto91749
orthoMCL 1 0.900 - - OOG6_103244
Panther 1 1.100 - - LDO PTHR31551
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R274
SonicParanoid 1 1.000 - - X3935
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.